Gene Information

Name : CAP2UW1_0089 (CAP2UW1_0089)
Accession : YP_003165386.1
Strain : Candidatus Accumulibacter phosphatis UW-1
Genome accession: NC_013194
Putative virulence/resistance : Unknown
Product : IS66 Orf2 family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 102464 - 102817 bp
Length : 354 bp
Strand : +
Note : PFAM: IS66 Orf2 family protein; KEGG: eba:ebB55 transposase, fragment

DNA sequence :
ATGAGCGCGCCTATCGGCGCCGCGCCGGAGCGCATCTGGCTGGCTGTTGAAGCGGTGGACATGCGCCTGGGTATCGATGG
CCTGTCGGTCCGCATCCAGGCCAGTCTCGGGCGCTCGCCTTGTGACGGTACCGCCTACGCCTTCACCAACCGGCGACGCA
GCCGGCTCAAACTGCTGGTCTGGGATGGCACCGGCGTGTGGCTGTCGCAACGCCGGTTGCACCGCGGTTATTTCACCTGG
CCGAGCGCCAGCGACCCCGTCTTCGCCCTGACGGCGGCGCAATGGCGTTGGCTGACTGCCGGCGTTGACTGGCAACGTCG
GGACGCCCCGGCACCCGCCAACTGGCAAGTCTAG

Protein sequence :
MSAPIGAAPERIWLAVEAVDMRLGIDGLSVRIQASLGRSPCDGTAYAFTNRRRSRLKLLVWDGTGVWLSQRRLHRGYFTW
PSASDPVFALTAAQWRWLTAGVDWQRRDAPAPANWQV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
Z1163 NP_286698.1 hypothetical protein Not tested TAI Protein 2e-19 48
Z1602 NP_287106.1 hypothetical protein Not tested TAI Protein 2e-19 48
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 5e-12 43
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 5e-12 43
EXB18 ABD94704.1 ISPpu14 transposase Orf2 Not tested ExoU island B Protein 3e-14 42
RL060 AAP84185.1 transposase Not tested PAPI-1 Protein 5e-14 42
unnamed AAC31493.1 L0014 Not tested LEE Protein 2e-12 41
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 3e-12 41
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 2e-12 41
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 3e-12 41
unnamed AAL99258.1 unknown Not tested LEE Protein 2e-12 41
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 3e-12 41
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 3e-12 41
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 2e-12 41
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-12 41
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-12 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CAP2UW1_0089 YP_003165386.1 IS66 Orf2 family protein VFG1709 Protein 9e-13 41
CAP2UW1_0089 YP_003165386.1 IS66 Orf2 family protein VFG0792 Protein 9e-13 41
CAP2UW1_0089 YP_003165386.1 IS66 Orf2 family protein VFG1698 Protein 5e-13 41