
|
Name : CAP2UW1_3300 (CAP2UW1_3300) Accession : YP_003168494.1 Strain : Candidatus Accumulibacter phosphatis UW-1 Genome accession: NC_013194 Putative virulence/resistance : Virulence Product : winged helix family two component transcriptional regulator Function : - COG functional category : T : Signal transduction mechanisms COG ID : COG0745 EC number : - Position : 3796742 - 3797401 bp Length : 660 bp Strand : + Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: lch:Lcho_1866 two component transcriptional regulator, winged helix family DNA sequence : ATGCGACTGCTACTGATCGAAGACGACGAACTGCTCGGCGAGGGCCTGCGCGACTTCCTGAGCGGCGAGGGCCACCGCGT CGACTGGTGCCGCAGCCTGCACGAAGCAACGGCCTACCGCGGCGAGCCATACGACGCCTTGCTCGTCGACTGGCAGTTAC CGGATGGCTCCGGCCTCGCTTGGCTGCGTGCGCGGCGCAGTGCCCGCGACAGTACTCCGGCATTGATGCTGACCGCGCGC GACCTGCTCAGCGACCGTGTTCAGGGCCTCGACAGCGGCGCCGACGACTACCTCGTCAAACCGTTCGCCCCGGAAGAACT GTCGGCTCGGTTGCGGGCGGTGTGCCGGCGTAGCGCCGGCGGCGCGGCGTCGCGGCTGTCCTTCGGCAGGGTCGAGGTCG ACCTGACGGCGCGCAGCGCCTGGTTGGCCGGCCAACGCATCGAGCTGACCGGCCGCGAGTGGTCGATCCTCGAAGCTCTG GTCCTGCGCGCCGGACGCATCGTCCCCAAAGCCGACCTCGAGCGACTGGTGCTTGGCTTCGAAGCGGAGTTGGCGAGCAA CGCCATCGAGGTGCATGTGTCGGGCCTGCGACGCAAACTCGGCTTTGATCTCGTCGAAACCGTACGCGGGCTTGGCTACC GCATTGCGGCACAGGCATGA Protein sequence : MRLLLIEDDELLGEGLRDFLSGEGHRVDWCRSLHEATAYRGEPYDALLVDWQLPDGSGLAWLRARRSARDSTPALMLTAR DLLSDRVQGLDSGADDYLVKPFAPEELSARLRAVCRRSAGGAASRLSFGRVEVDLTARSAWLAGQRIELTGREWSILEAL VLRAGRIVPKADLERLVLGFEAELASNAIEVHVSGLRRKLGFDLVETVRGLGYRIAAQA |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| armR | AAN62112.1 | putative response-regulator ArmR | Not tested | PAGI-2(C) | Protein | 1e-27 | 43 |
| copR | NP_460069.2 | transcriptional regulatory protein YedW | Not tested | SPI-5 | Protein | 3e-18 | 42 |
| copR | AAC33719.1 | regulatory protein CopR | Not tested | SPI-5 | Protein | 1e-17 | 41 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| CAP2UW1_3300 | YP_003168494.1 | winged helix family two component transcriptional regulator | NC_002516.2.879194.p | Protein | 1e-22 | 43 |
| CAP2UW1_3300 | YP_003168494.1 | winged helix family two component transcriptional regulator | BAC0083 | Protein | 3e-23 | 43 |
| CAP2UW1_3300 | YP_003168494.1 | winged helix family two component transcriptional regulator | BAC0487 | Protein | 1e-27 | 43 |
| CAP2UW1_3300 | YP_003168494.1 | winged helix family two component transcriptional regulator | CP000647.1.gene1136. | Protein | 2e-22 | 42 |
| CAP2UW1_3300 | YP_003168494.1 | winged helix family two component transcriptional regulator | BAC0530 | Protein | 3e-22 | 42 |
| CAP2UW1_3300 | YP_003168494.1 | winged helix family two component transcriptional regulator | CP001918.1.gene2526. | Protein | 1e-21 | 41 |
| CAP2UW1_3300 | YP_003168494.1 | winged helix family two component transcriptional regulator | BAC0638 | Protein | 3e-19 | 41 |
| CAP2UW1_3300 | YP_003168494.1 | winged helix family two component transcriptional regulator | CP000675.2.gene1535. | Protein | 6e-21 | 41 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| CAP2UW1_3300 | YP_003168494.1 | winged helix family two component transcriptional regulator | VFG0473 | Protein | 1e-28 | 43 |
| CAP2UW1_3300 | YP_003168494.1 | winged helix family two component transcriptional regulator | VFG1390 | Protein | 1e-19 | 43 |
| CAP2UW1_3300 | YP_003168494.1 | winged helix family two component transcriptional regulator | VFG0596 | Protein | 1e-18 | 42 |