Gene Information

Name : CAP2UW1_3300 (CAP2UW1_3300)
Accession : YP_003168494.1
Strain : Candidatus Accumulibacter phosphatis UW-1
Genome accession: NC_013194
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3796742 - 3797401 bp
Length : 660 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: lch:Lcho_1866 two component transcriptional regulator, winged helix family

DNA sequence :
ATGCGACTGCTACTGATCGAAGACGACGAACTGCTCGGCGAGGGCCTGCGCGACTTCCTGAGCGGCGAGGGCCACCGCGT
CGACTGGTGCCGCAGCCTGCACGAAGCAACGGCCTACCGCGGCGAGCCATACGACGCCTTGCTCGTCGACTGGCAGTTAC
CGGATGGCTCCGGCCTCGCTTGGCTGCGTGCGCGGCGCAGTGCCCGCGACAGTACTCCGGCATTGATGCTGACCGCGCGC
GACCTGCTCAGCGACCGTGTTCAGGGCCTCGACAGCGGCGCCGACGACTACCTCGTCAAACCGTTCGCCCCGGAAGAACT
GTCGGCTCGGTTGCGGGCGGTGTGCCGGCGTAGCGCCGGCGGCGCGGCGTCGCGGCTGTCCTTCGGCAGGGTCGAGGTCG
ACCTGACGGCGCGCAGCGCCTGGTTGGCCGGCCAACGCATCGAGCTGACCGGCCGCGAGTGGTCGATCCTCGAAGCTCTG
GTCCTGCGCGCCGGACGCATCGTCCCCAAAGCCGACCTCGAGCGACTGGTGCTTGGCTTCGAAGCGGAGTTGGCGAGCAA
CGCCATCGAGGTGCATGTGTCGGGCCTGCGACGCAAACTCGGCTTTGATCTCGTCGAAACCGTACGCGGGCTTGGCTACC
GCATTGCGGCACAGGCATGA

Protein sequence :
MRLLLIEDDELLGEGLRDFLSGEGHRVDWCRSLHEATAYRGEPYDALLVDWQLPDGSGLAWLRARRSARDSTPALMLTAR
DLLSDRVQGLDSGADDYLVKPFAPEELSARLRAVCRRSAGGAASRLSFGRVEVDLTARSAWLAGQRIELTGREWSILEAL
VLRAGRIVPKADLERLVLGFEAELASNAIEVHVSGLRRKLGFDLVETVRGLGYRIAAQA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 1e-27 43
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-18 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-17 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CAP2UW1_3300 YP_003168494.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 1e-22 43
CAP2UW1_3300 YP_003168494.1 winged helix family two component transcriptional regulator BAC0083 Protein 3e-23 43
CAP2UW1_3300 YP_003168494.1 winged helix family two component transcriptional regulator BAC0487 Protein 1e-27 43
CAP2UW1_3300 YP_003168494.1 winged helix family two component transcriptional regulator CP000647.1.gene1136. Protein 2e-22 42
CAP2UW1_3300 YP_003168494.1 winged helix family two component transcriptional regulator BAC0530 Protein 3e-22 42
CAP2UW1_3300 YP_003168494.1 winged helix family two component transcriptional regulator CP001918.1.gene2526. Protein 1e-21 41
CAP2UW1_3300 YP_003168494.1 winged helix family two component transcriptional regulator CP000675.2.gene1535. Protein 6e-21 41
CAP2UW1_3300 YP_003168494.1 winged helix family two component transcriptional regulator BAC0638 Protein 3e-19 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CAP2UW1_3300 YP_003168494.1 winged helix family two component transcriptional regulator VFG0473 Protein 1e-28 43
CAP2UW1_3300 YP_003168494.1 winged helix family two component transcriptional regulator VFG1390 Protein 1e-19 43
CAP2UW1_3300 YP_003168494.1 winged helix family two component transcriptional regulator VFG0596 Protein 1e-18 42