Gene Information

Name : CAP2UW1_0147 (CAP2UW1_0147)
Accession : YP_003165436.1
Strain : Candidatus Accumulibacter phosphatis UW-1
Genome accession: NC_013194
Putative virulence/resistance : Virulence
Product : winged helix family two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 175971 - 176654 bp
Length : 684 bp
Strand : -
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: rfr:Rfer_0422 two component heavy metal response transcriptional regulator, winged helix family

DNA sequence :
ATGAAGATCCTGGTCGTCGAAGACGAGCCGAAGACAGGCAACTACCTCAAGCAGGGTCTGCTGGAAGCCGGTTTCGTCGT
CGATCTGGCACGCGACGGAGAAGACGGCATGCACTGCGCGCTGACCGAGGCCTACGATCTGGTGATTCTAGACGTGATGT
TGCCGGGCATCGATGGCTGGTCGGTGCTGCGGGGAATTCGCAAGTCGGGGAAGGACATGCCGGTATTGTTCCTGACAGCC
CGCGATCATGTCGATGATCGGGTTCGCGGCCTCGAACTGGGCGCCGACGACTATTTGGTGAAGCCGTTCGCGTTCTCCGA
ACTGCTGGCGCGGGTGCGCAGCCTGCTGCGCCGCGGCGGCAAGGCCACGGAGTCGGAGTTTCTGCGCGCCGCCGATCTGG
AACTCGACTTGATGCGCCGACGGGTGAACCGTTCCGGCAAACGAATCGATCTGACGGCCAAGGAGTTCGCCCTGCTGGAA
CTGCTGCTGCGCCGTCAGGGCGAGGTTCTGCCGCGCTCGCTGATCGCCTCGCAGGTCTGGGACATGAACTTCGACAGCGA
TACCAACGTGATCGAGGTGGCGATCCGGCGCCTGCGGGCAAAGATGGACGATGGCTTCGAGCCGAAACTGATCCGTACCG
TACGTGGCATGGGCTATGTTCTGGAGGTGACGGCATGCGCTTGA

Protein sequence :
MKILVVEDEPKTGNYLKQGLLEAGFVVDLARDGEDGMHCALTEAYDLVILDVMLPGIDGWSVLRGIRKSGKDMPVLFLTA
RDHVDDRVRGLELGADDYLVKPFAFSELLARVRSLLRRGGKATESEFLRAADLELDLMRRRVNRSGKRIDLTAKEFALLE
LLLRRQGEVLPRSLIASQVWDMNFDSDTNVIEVAIRRLRAKMDDGFEPKLIRTVRGMGYVLEVTACA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 9e-59 59
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-58 58

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CAP2UW1_0147 YP_003165436.1 winged helix family two component heavy metal response transcriptional regulator BAC0083 Protein 1e-73 73
CAP2UW1_0147 YP_003165436.1 winged helix family two component heavy metal response transcriptional regulator BAC0638 Protein 3e-70 72
CAP2UW1_0147 YP_003165436.1 winged helix family two component heavy metal response transcriptional regulator BAC0197 Protein 2e-71 69
CAP2UW1_0147 YP_003165436.1 winged helix family two component heavy metal response transcriptional regulator BAC0111 Protein 9e-73 67
CAP2UW1_0147 YP_003165436.1 winged helix family two component heavy metal response transcriptional regulator BAC0125 Protein 2e-68 65
CAP2UW1_0147 YP_003165436.1 winged helix family two component heavy metal response transcriptional regulator BAC0308 Protein 6e-68 64
CAP2UW1_0147 YP_003165436.1 winged helix family two component heavy metal response transcriptional regulator BAC0347 Protein 2e-65 61
CAP2UW1_0147 YP_003165436.1 winged helix family two component heavy metal response transcriptional regulator NC_002952.2859905.p0 Protein 2e-34 43
CAP2UW1_0147 YP_003165436.1 winged helix family two component heavy metal response transcriptional regulator NC_007793.3914279.p0 Protein 2e-34 43
CAP2UW1_0147 YP_003165436.1 winged helix family two component heavy metal response transcriptional regulator NC_003923.1003749.p0 Protein 2e-34 43
CAP2UW1_0147 YP_003165436.1 winged helix family two component heavy metal response transcriptional regulator NC_002745.1124361.p0 Protein 2e-34 43
CAP2UW1_0147 YP_003165436.1 winged helix family two component heavy metal response transcriptional regulator NC_009782.5559369.p0 Protein 2e-34 43
CAP2UW1_0147 YP_003165436.1 winged helix family two component heavy metal response transcriptional regulator NC_002951.3237708.p0 Protein 2e-34 43
CAP2UW1_0147 YP_003165436.1 winged helix family two component heavy metal response transcriptional regulator NC_002758.1121668.p0 Protein 2e-34 43
CAP2UW1_0147 YP_003165436.1 winged helix family two component heavy metal response transcriptional regulator NC_009641.5332272.p0 Protein 2e-34 43
CAP2UW1_0147 YP_003165436.1 winged helix family two component heavy metal response transcriptional regulator NC_013450.8614421.p0 Protein 2e-34 43
CAP2UW1_0147 YP_003165436.1 winged helix family two component heavy metal response transcriptional regulator NC_007622.3794472.p0 Protein 3e-34 43
CAP2UW1_0147 YP_003165436.1 winged helix family two component heavy metal response transcriptional regulator BAC0487 Protein 4e-28 42
CAP2UW1_0147 YP_003165436.1 winged helix family two component heavy metal response transcriptional regulator NC_002516.2.879194.p Protein 4e-31 42
CAP2UW1_0147 YP_003165436.1 winged helix family two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 1e-36 41
CAP2UW1_0147 YP_003165436.1 winged helix family two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 1e-36 41
CAP2UW1_0147 YP_003165436.1 winged helix family two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 1e-36 41
CAP2UW1_0147 YP_003165436.1 winged helix family two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 1e-36 41
CAP2UW1_0147 YP_003165436.1 winged helix family two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 1e-36 41
CAP2UW1_0147 YP_003165436.1 winged helix family two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 1e-36 41
CAP2UW1_0147 YP_003165436.1 winged helix family two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 1e-36 41
CAP2UW1_0147 YP_003165436.1 winged helix family two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 1e-36 41
CAP2UW1_0147 YP_003165436.1 winged helix family two component heavy metal response transcriptional regulator HE999704.1.gene1528. Protein 3e-28 41
CAP2UW1_0147 YP_003165436.1 winged helix family two component heavy metal response transcriptional regulator AE000516.2.gene3505. Protein 2e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CAP2UW1_0147 YP_003165436.1 winged helix family two component heavy metal response transcriptional regulator VFG0596 Protein 4e-59 59
CAP2UW1_0147 YP_003165436.1 winged helix family two component heavy metal response transcriptional regulator VFG1390 Protein 1e-42 49
CAP2UW1_0147 YP_003165436.1 winged helix family two component heavy metal response transcriptional regulator VFG1389 Protein 1e-36 46
CAP2UW1_0147 YP_003165436.1 winged helix family two component heavy metal response transcriptional regulator VFG1386 Protein 9e-37 44
CAP2UW1_0147 YP_003165436.1 winged helix family two component heavy metal response transcriptional regulator VFG0473 Protein 3e-32 42