Gene Information

Name : Lebu_1041 (Lebu_1041)
Accession : YP_003163932.1
Strain : Leptotrichia buccalis DSM 1135
Genome accession: NC_013192
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1133785 - 1134465 bp
Length : 681 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: btl:BALH_2874 two-component response regulator

DNA sequence :
ATGAGAATTTTAGTAATCGAAGATGAGGAAAACTTAAATGATATAATTGTAAAAAAATTAACCATGGAAAAATATGGCGT
TGACAGCTGTCTTAATGGAACAGATGCCCTTAACTATATTTTTTCAACTGAATATGATGTTATTGTTTCTGATATTATGT
TGCCAGGATTGGACGGATTTGAAATTTTGAAAAAAATAAGGGAAAATGGAATAAAAACTCCCGTTTTGCTGCTTACTGCA
AGAGATGGGATAGAAGATAGAGTAAAAGGACTAGATTACGGTGCTGATGACTATTTGGTAAAACCATTCGCATTTGACGA
GCTTATGGCAAGAATAAGAGTTCTTTTACGTAGAAATCCAACCAGCAACTCCAATGCAAGCAATGTCTTTAAAATTGCAA
ATCTGACAGTGAACTGCAATTCCCACGATGTTTTTCGGGATGAAACGTTCATCAAGCTGTCAACAAGGGAATTTACAATT
TTAGAATATATGATTAGAAATAAGGAGCGTGTCCTTTCCAGAGAACAGATTGAACAGCACATCTGGAATTATGACTATGA
AGGCGGGACAAATGTTATTGATGTCTATATTAGGTATTTAAGAAGAAAAATTGATAAAGGATTTGAGCCAAAACTAATTC
ATACAATTCGTGGAATTGGCTATGTTTTAAAAGTAGAATAA

Protein sequence :
MRILVIEDEENLNDIIVKKLTMEKYGVDSCLNGTDALNYIFSTEYDVIVSDIMLPGLDGFEILKKIRENGIKTPVLLLTA
RDGIEDRVKGLDYGADDYLVKPFAFDELMARIRVLLRRNPTSNSNASNVFKIANLTVNCNSHDVFRDETFIKLSTREFTI
LEYMIRNKERVLSREQIEQHIWNYDYEGGTNVIDVYIRYLRRKIDKGFEPKLIHTIRGIGYVLKVE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-41 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-40 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Lebu_1041 YP_003163932.1 winged helix family two component transcriptional regulator BAC0638 Protein 3e-46 48
Lebu_1041 YP_003163932.1 winged helix family two component transcriptional regulator BAC0125 Protein 3e-48 47
Lebu_1041 YP_003163932.1 winged helix family two component transcriptional regulator BAC0308 Protein 6e-46 47
Lebu_1041 YP_003163932.1 winged helix family two component transcriptional regulator BAC0083 Protein 3e-48 45
Lebu_1041 YP_003163932.1 winged helix family two component transcriptional regulator BAC0111 Protein 2e-49 45
Lebu_1041 YP_003163932.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 3e-41 44
Lebu_1041 YP_003163932.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 3e-41 44
Lebu_1041 YP_003163932.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 3e-41 44
Lebu_1041 YP_003163932.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 3e-41 44
Lebu_1041 YP_003163932.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 3e-41 44
Lebu_1041 YP_003163932.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 3e-41 44
Lebu_1041 YP_003163932.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 3e-41 44
Lebu_1041 YP_003163932.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 3e-41 44
Lebu_1041 YP_003163932.1 winged helix family two component transcriptional regulator BAC0347 Protein 1e-43 44
Lebu_1041 YP_003163932.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 6e-35 44
Lebu_1041 YP_003163932.1 winged helix family two component transcriptional regulator BAC0197 Protein 5e-46 44
Lebu_1041 YP_003163932.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 4e-35 41
Lebu_1041 YP_003163932.1 winged helix family two component transcriptional regulator BAC0288 Protein 4e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Lebu_1041 YP_003163932.1 winged helix family two component transcriptional regulator VFG1390 Protein 3e-50 43
Lebu_1041 YP_003163932.1 winged helix family two component transcriptional regulator VFG1386 Protein 6e-49 42
Lebu_1041 YP_003163932.1 winged helix family two component transcriptional regulator VFG0596 Protein 9e-42 41