Gene Information

Name : Bfae_20650 (Bfae_20650)
Accession : YP_003155462.1
Strain : Brachybacterium faecium DSM 4810
Genome accession: NC_013172
Putative virulence/resistance : Virulence
Product : response regulator with CheY-like receiver domain and winged-helix DNA-binding domain
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2309202 - 2309897 bp
Length : 696 bp
Strand : -
Note : PFAM: Transcriptional regulatory protein, C terminal; Response regulator receiver domain

DNA sequence :
ATGACGAGCATGACGACGCCTTCCCGGATTCTCGTGGTGGATGACGACCAGGCGATCGCCGAGATGGTCGGCATCGTTCT
GCGTGGCAAGGGCTACGAGGTCGCCACCTCGCCCGACGGTGCCTCGGCGCTGGAGACCTTCCCGCGCCTGCGGCCCGATC
TGGTCCTGCTCGACCTCATGCTGCCCGGCATGGACGGCATCGAGGTGTGCCGTCGGCTGCGCCGCGAGTCCGGCGTGCCG
ATCATCATGCTCACCGCCCGCACCGACACCGCGGACGTGGTCGAGGGGCTCGAGGCCGGGGCCGACGACTACCTCACCAA
GCCCTTCGAGCCCGAGGAGCTCGTGGCCCGGATCAAGGCGCGGGTGCGCCGGTCGGAGGAGCCGACCACGGAGCAGCTGA
CGATCGGTGACCTGACCATCGACGTCGACGGGCACGAGGTGCGCCGCGGCGATCAGCTGATCTCCCTCACCCCGCTCGAG
TTCGACCTGCTCACGCAGCTGGCGCGCAAGCCGTGGCAGGTCTTCACCCGCGACGTGCTGCTGCGCGACGTGTGGGGGTA
CCGCCACAGCGCGGACACGCGCCTGGTGAACGTCCACGTCCAGCGGCTGCGCTCCAAGATCGAGCACGATCCGGAGAACC
CGTCGATCGTGGTGACCGTGCGCGGTGTCGGCTACCGCGCCGGGGGCGCGTCCTGA

Protein sequence :
MTSMTTPSRILVVDDDQAIAEMVGIVLRGKGYEVATSPDGASALETFPRLRPDLVLLDLMLPGMDGIEVCRRLRRESGVP
IIMLTARTDTADVVEGLEAGADDYLTKPFEPEELVARIKARVRRSEEPTTEQLTIGDLTIDVDGHEVRRGDQLISLTPLE
FDLLTQLARKPWQVFTRDVLLRDVWGYRHSADTRLVNVHVQRLRSKIEHDPENPSIVVTVRGVGYRAGGAS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-32 44
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-32 43
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-24 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-24 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bfae_20650 YP_003155462.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AE000516.2.gene3505. Protein 1e-59 68
Bfae_20650 YP_003155462.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain HE999704.1.gene2815. Protein 1e-36 48
Bfae_20650 YP_003155462.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002952.2859905.p0 Protein 2e-38 46
Bfae_20650 YP_003155462.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002951.3237708.p0 Protein 2e-38 46
Bfae_20650 YP_003155462.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_003923.1003749.p0 Protein 2e-38 46
Bfae_20650 YP_003155462.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002758.1121668.p0 Protein 2e-38 46
Bfae_20650 YP_003155462.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_009641.5332272.p0 Protein 2e-38 46
Bfae_20650 YP_003155462.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_013450.8614421.p0 Protein 2e-38 46
Bfae_20650 YP_003155462.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007793.3914279.p0 Protein 2e-38 46
Bfae_20650 YP_003155462.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007622.3794472.p0 Protein 2e-38 46
Bfae_20650 YP_003155462.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002745.1124361.p0 Protein 2e-38 46
Bfae_20650 YP_003155462.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_009782.5559369.p0 Protein 2e-38 46
Bfae_20650 YP_003155462.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_012469.1.7685629. Protein 4e-36 45
Bfae_20650 YP_003155462.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AE016830.1.gene1681. Protein 4e-35 44
Bfae_20650 YP_003155462.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0125 Protein 5e-27 44
Bfae_20650 YP_003155462.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AF155139.2.orf0.gene Protein 1e-30 43
Bfae_20650 YP_003155462.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain HE999704.1.gene1528. Protein 2e-30 42
Bfae_20650 YP_003155462.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_012469.1.7686381. Protein 1e-34 42
Bfae_20650 YP_003155462.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002952.2859858.p0 Protein 5e-32 41
Bfae_20650 YP_003155462.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AE015929.1.gene1106. Protein 8e-28 41
Bfae_20650 YP_003155462.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007622.3794948.p0 Protein 5e-32 41
Bfae_20650 YP_003155462.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_003923.1003417.p0 Protein 5e-32 41
Bfae_20650 YP_003155462.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_013450.8614146.p0 Protein 5e-32 41
Bfae_20650 YP_003155462.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002951.3238224.p0 Protein 5e-32 41
Bfae_20650 YP_003155462.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007793.3914065.p0 Protein 5e-32 41
Bfae_20650 YP_003155462.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002758.1121390.p0 Protein 5e-32 41
Bfae_20650 YP_003155462.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_010079.5776364.p0 Protein 5e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bfae_20650 YP_003155462.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1390 Protein 2e-33 46
Bfae_20650 YP_003155462.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1389 Protein 7e-27 46
Bfae_20650 YP_003155462.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1702 Protein 6e-33 44
Bfae_20650 YP_003155462.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1563 Protein 9e-33 43
Bfae_20650 YP_003155462.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG0596 Protein 8e-25 42
Bfae_20650 YP_003155462.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1386 Protein 3e-28 42