Gene Information

Name : Apre_0086 (Apre_0086)
Accession : YP_003151860.1
Strain : Anaerococcus prevotii DSM 20548
Genome accession: NC_013171
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 107132 - 107803 bp
Length : 672 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: amc:MADE_02297 response regulator in two- component regulatory system with PhoQ

DNA sequence :
ATGAAAGTACTGATAGTTGAAGATGAGAGAAAGCTTTTGAGACTTCTTGATGAAGGATTAAGTCTTTTAGGCTATGTTAC
AGATATGGCAAGGGATGGAAAAGAGGCCCTTGACCTTGCTTTTGTAGAAGATTATGACATTATTATCCTAGATATTAATC
TACCGAAGAAGGACGGCTTCGAGGTCCTAAGAGATATAAGGCAATTTGATAAGGAAGTAAACATTATAATGCTTACAGCA
AGAAGTGATATAGACGATAGGGTGAAGGGCCTTGACTTTGGAGCCAACGACTATATGACCAAGCCTTTTGATCTTAAGGA
GCTTGATGCGAGGATGCGCTCTCTTCTTAGGAGAAAGTCCATCATGGAAGAAAAAGATATCACAATTGATGGGATAACTT
TTGATACTGTCAAAAGAGAAGTTATCTTTGAGGGCAGTCCCCTTACTCTAACAGCTAAGGAGACTGGTATTATCGAATAT
CTCTTCCTAAATAGGGAAAGGTATGTGAGTGTCGAGGAGCTTATGAACCACGTCTGGGATTCCAATGCAGATGACTTCTC
TAATACGGTAAGAGTTCATATGTCTTCCTTGAGGAAAAAGATAAAGAAGGCCACAGGAAAAAATTATATAGAAAATGTTA
TCGGCAAGGGTTATAAGATTTATGAAAAATAA

Protein sequence :
MKVLIVEDERKLLRLLDEGLSLLGYVTDMARDGKEALDLAFVEDYDIIILDINLPKKDGFEVLRDIRQFDKEVNIIMLTA
RSDIDDRVKGLDFGANDYMTKPFDLKELDARMRSLLRRKSIMEEKDITIDGITFDTVKREVIFEGSPLTLTAKETGIIEY
LFLNRERYVSVEELMNHVWDSNADDFSNTVRVHMSSLRKKIKKATGKNYIENVIGKGYKIYEK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-28 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-27 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Apre_0086 YP_003151860.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 4e-25 42
Apre_0086 YP_003151860.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 4e-25 42
Apre_0086 YP_003151860.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 4e-25 42
Apre_0086 YP_003151860.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 4e-25 42
Apre_0086 YP_003151860.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 4e-25 42
Apre_0086 YP_003151860.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 4e-25 42
Apre_0086 YP_003151860.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 4e-23 42
Apre_0086 YP_003151860.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 4e-25 42
Apre_0086 YP_003151860.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 4e-25 42
Apre_0086 YP_003151860.1 winged helix family two component transcriptional regulator BAC0111 Protein 7e-30 41
Apre_0086 YP_003151860.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-24 41
Apre_0086 YP_003151860.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 8e-25 41
Apre_0086 YP_003151860.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 8e-25 41
Apre_0086 YP_003151860.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-24 41
Apre_0086 YP_003151860.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 7e-25 41
Apre_0086 YP_003151860.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 8e-25 41
Apre_0086 YP_003151860.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 8e-25 41
Apre_0086 YP_003151860.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 8e-25 41
Apre_0086 YP_003151860.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 8e-25 41
Apre_0086 YP_003151860.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 8e-25 41
Apre_0086 YP_003151860.1 winged helix family two component transcriptional regulator BAC0197 Protein 4e-26 41
Apre_0086 YP_003151860.1 winged helix family two component transcriptional regulator BAC0487 Protein 4e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Apre_0086 YP_003151860.1 winged helix family two component transcriptional regulator VFG0596 Protein 2e-28 42