Gene Information

Name : Apre_1374 (Apre_1374)
Accession : YP_003153118.1
Strain : Anaerococcus prevotii DSM 20548
Genome accession: NC_013171
Putative virulence/resistance : Resistance
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1479473 - 1480132 bp
Length : 660 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: bcr:BCAH187_A1453 DNA-binding response regulator

DNA sequence :
ATGATATATGTTGTCGAAGACGATAAGTCTATAAGAAATTTAGTAGAATATGCCTTAAGAGAAAAAGGCTACGAGGTCGC
AGGCTACGAAGATGGATCACAGATAGTAAGTGATGTAAAAGATAGTCCGGGCGAGCTTTTAATCCTTGATATAATGCTAC
CTGAAAAGGATGGAATCACTATACTTAAGGAGATTAGAGAGTTTTCTGATATACCCATAATAATGCTTACAGCTAGGACT
GATGAGTTTGATAAGGTGATGGGTCTTGACCTAGGGGCCGATGATTATATTACAAAACCCTTCTCAATCTTAGAATTAAT
AAGCAGAGTCAAGGCTGTTCTTAGAAGAAGCAAGAAGAAGGATACAGATCACATAAGCTATAAAGAAGTAAGACTTAATA
TGAAAAAGCGTTCTGTTAAGGTAGACGGAGTGAAAATAGACTTAACCTACAAGGAATTTGAGATGCTACTTCTTTTTATG
TCTAATATAGGAAATGTAATAACCCGTGATGACTTCCTACTCAAAGTTTGGGGCTACGACTACGAGGGAGAGACCAGAAC
TGTAGATGTTCATATAGCAAGTCTTAGGGCTAAGCTAAAAAATGCGGGAAAATATATAGAAACTGTTAGAAATCTAGGTT
ATAAATTCGGTGAAATATGA

Protein sequence :
MIYVVEDDKSIRNLVEYALREKGYEVAGYEDGSQIVSDVKDSPGELLILDIMLPEKDGITILKEIREFSDIPIIMLTART
DEFDKVMGLDLGADDYITKPFSILELISRVKAVLRRSKKKDTDHISYKEVRLNMKKRSVKVDGVKIDLTYKEFEMLLLFM
SNIGNVITRDDFLLKVWGYDYEGETRTVDVHIASLRAKLKNAGKYIETVRNLGYKFGEI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 1e-32 42
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 5e-33 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Apre_1374 YP_003153118.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-41 46
Apre_1374 YP_003153118.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 4e-41 46
Apre_1374 YP_003153118.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 4e-41 46
Apre_1374 YP_003153118.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 4e-41 46
Apre_1374 YP_003153118.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-41 46
Apre_1374 YP_003153118.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 4e-41 46
Apre_1374 YP_003153118.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 4e-41 46
Apre_1374 YP_003153118.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 4e-41 46
Apre_1374 YP_003153118.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 4e-41 46
Apre_1374 YP_003153118.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 4e-41 45
Apre_1374 YP_003153118.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 3e-38 43
Apre_1374 YP_003153118.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 1e-38 43
Apre_1374 YP_003153118.1 winged helix family two component transcriptional regulator AF310956.2.orf0.gene Protein 5e-33 42
Apre_1374 YP_003153118.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-33 42
Apre_1374 YP_003153118.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-33 42
Apre_1374 YP_003153118.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-33 42
Apre_1374 YP_003153118.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-33 42
Apre_1374 YP_003153118.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-33 42
Apre_1374 YP_003153118.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-33 42
Apre_1374 YP_003153118.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 3e-30 42
Apre_1374 YP_003153118.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-33 42
Apre_1374 YP_003153118.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-33 42
Apre_1374 YP_003153118.1 winged helix family two component transcriptional regulator AE016830.1.gene2255. Protein 2e-33 41
Apre_1374 YP_003153118.1 winged helix family two component transcriptional regulator U35369.1.gene1.p01 Protein 2e-33 41
Apre_1374 YP_003153118.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 8e-37 41
Apre_1374 YP_003153118.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 2e-37 41
Apre_1374 YP_003153118.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 5e-33 41