Gene Information

Name : Kkor_1358 (Kkor_1358)
Accession : YP_003146539.1
Strain : Kangiella koreensis DSM 16069
Genome accession: NC_013166
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 1453369 - 1453749 bp
Length : 381 bp
Strand : +
Note : PFAM: Transcription regulator MerR DNA binding; regulatory protein MerR; SMART: regulatory protein MerR; KEGG: hne:HNE_1380 MerR family transcriptional regulator

DNA sequence :
ATGTTACCAATTGGCAAATTTGCAAAGGCAGGCGGAGTTGGAGTTGAAACCATCAGGTTTTATCAGCGTAAAGGTCTGCT
CAGGATTCCCAAACAAGAAGGCGGAATTCGTCGTTATGATGATCGAGACATCAGACAACTTAAATTTATATTAAAAGCTA
AAGCCGCAGGATTCACGCTGGCGGAGATAAAAGAGTTAATCGTACTCGACTCAAGTAACGACCGACATAAAGCGTACGAG
CTCGCAACGTCAAGGGTCAGTGAACTCGATAAGAAAATTGCCGAACTGCAACAGGCAAGAAACGCTTTGCAGAAACTTGC
GACAGAATGTCGCGGCAGCAAAACAGGCCCATGCCCAATAATCGAAGCATTTGATGATTAA

Protein sequence :
MLPIGKFAKAGGVGVETIRFYQRKGLLRIPKQEGGIRRYDDRDIRQLKFILKAKAAGFTLAEIKELIVLDSSNDRHKAYE
LATSRVSELDKKIAELQQARNALQKLATECRGSKTGPCPIIEAFDD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR AGK07025.1 MerR Not tested SGI1 Protein 5e-17 44
merR AGK07083.1 MerR Not tested SGI1 Protein 5e-17 44
merR ACK44535.1 MerR Not tested SGI1 Protein 2e-17 44
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 2e-17 44
merR AFG30124.1 MerR Not tested PAGI-2 Protein 2e-17 44
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 3e-17 44
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 1e-17 44
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 4e-16 42
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 7e-15 42
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 8e-17 42
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 1e-16 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Kkor_1358 YP_003146539.1 MerR family transcriptional regulator BAC0688 Protein 3e-17 43
Kkor_1358 YP_003146539.1 MerR family transcriptional regulator BAC0683 Protein 1e-16 42
Kkor_1358 YP_003146539.1 MerR family transcriptional regulator BAC0687 Protein 3e-16 41
Kkor_1358 YP_003146539.1 MerR family transcriptional regulator BAC0686 Protein 4e-16 41
Kkor_1358 YP_003146539.1 MerR family transcriptional regulator BAC0232 Protein 3e-16 41
Kkor_1358 YP_003146539.1 MerR family transcriptional regulator BAC0684 Protein 1e-16 41
Kkor_1358 YP_003146539.1 MerR family transcriptional regulator BAC0689 Protein 4e-16 41