Gene Information

Name : Kkor_1292 (Kkor_1292)
Accession : YP_003146476.1
Strain : Kangiella koreensis DSM 16069
Genome accession: NC_013166
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1389230 - 1389922 bp
Length : 693 bp
Strand : -
Note : KEGG: sde:Sde_1948 response regulator receiver domain-containing protein; TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver

DNA sequence :
ATGAAGCTACTACTGGTTGAGGACGAACCGAAAACAGGGGATTACTTGCGACAAGGCTTAGGTGAAGCTGGCTTCGTGGT
TGTCCTTGTACGAAATGGGCTTGATGGTCACCATTTAGCTATGACCGAATCCTTTGACCTGATAATTCTTGATGTAATGC
TTCCTGACGTAGACGGTTGGCAAATAGTAAAAGCACTGCGCCAAATCGGATGCCGAACACCAGTATTGTTTCTTACTGCT
CGTGATAGTGTAGATGACCGCGTCAAAGGGCTGGAGCTTGGCGCAGATGACTATTTAGTGAAACCTTTTGCATTTGCTGA
GCTTCTAGCTCGTGTACGTACATTATTACGAAGAGGAGCCTCTCCGCCGAGCTCAAATCAACTCAAGATCTCCGATCTTA
CCCTTGACCTAATCAAGCATCGAGTCGAACGGTCAGGCTACAAAATCAACCTAAGTCACAAGGAATTCTGCCTTTTGGAA
TTGTTAGTAAGGCGCCAAGGTGAGGTGTTACCACGCTCACTTATTGCTTCGCAGGTATGGGACATGAACTTTGATTCGGA
CACTAATGTCATTGATGTAGCCATTCGACGATTAAGAGCCAAAATCGACGACAACTTTGAAACAAAACTAATTCATACCG
TGCGAGGTATGGGTTACATGCTAGATGCTGAATCAGATAATGATCTTGCCTGA

Protein sequence :
MKLLLVEDEPKTGDYLRQGLGEAGFVVVLVRNGLDGHHLAMTESFDLIILDVMLPDVDGWQIVKALRQIGCRTPVLFLTA
RDSVDDRVKGLELGADDYLVKPFAFAELLARVRTLLRRGASPPSSNQLKISDLTLDLIKHRVERSGYKINLSHKEFCLLE
LLVRRQGEVLPRSLIASQVWDMNFDSDTNVIDVAIRRLRAKIDDNFETKLIHTVRGMGYMLDAESDNDLA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-61 60
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-60 58

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Kkor_1292 YP_003146476.1 two component heavy metal response transcriptional regulator, winged helix family BAC0083 Protein 1e-73 69
Kkor_1292 YP_003146476.1 two component heavy metal response transcriptional regulator, winged helix family BAC0111 Protein 6e-75 67
Kkor_1292 YP_003146476.1 two component heavy metal response transcriptional regulator, winged helix family BAC0638 Protein 2e-67 67
Kkor_1292 YP_003146476.1 two component heavy metal response transcriptional regulator, winged helix family BAC0197 Protein 7e-68 64
Kkor_1292 YP_003146476.1 two component heavy metal response transcriptional regulator, winged helix family BAC0308 Protein 4e-65 64
Kkor_1292 YP_003146476.1 two component heavy metal response transcriptional regulator, winged helix family BAC0347 Protein 2e-68 63
Kkor_1292 YP_003146476.1 two component heavy metal response transcriptional regulator, winged helix family BAC0125 Protein 6e-66 62
Kkor_1292 YP_003146476.1 two component heavy metal response transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 2e-32 41
Kkor_1292 YP_003146476.1 two component heavy metal response transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 2e-32 41
Kkor_1292 YP_003146476.1 two component heavy metal response transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 2e-32 41
Kkor_1292 YP_003146476.1 two component heavy metal response transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 2e-32 41
Kkor_1292 YP_003146476.1 two component heavy metal response transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 3e-32 41
Kkor_1292 YP_003146476.1 two component heavy metal response transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 2e-32 41
Kkor_1292 YP_003146476.1 two component heavy metal response transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 2e-32 41
Kkor_1292 YP_003146476.1 two component heavy metal response transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 2e-32 41
Kkor_1292 YP_003146476.1 two component heavy metal response transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 3e-32 41
Kkor_1292 YP_003146476.1 two component heavy metal response transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 2e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Kkor_1292 YP_003146476.1 two component heavy metal response transcriptional regulator, winged helix family VFG0596 Protein 1e-61 60
Kkor_1292 YP_003146476.1 two component heavy metal response transcriptional regulator, winged helix family VFG1390 Protein 1e-42 44
Kkor_1292 YP_003146476.1 two component heavy metal response transcriptional regulator, winged helix family VFG1389 Protein 2e-34 43
Kkor_1292 YP_003146476.1 two component heavy metal response transcriptional regulator, winged helix family VFG1386 Protein 1e-35 41