Gene Information

Name : Svir_30940 (Svir_30940)
Accession : YP_003134896.1
Strain : Saccharomonospora viridis DSM 43017
Genome accession: NC_013159
Putative virulence/resistance : Virulence
Product : response regulator with CheY-like receiver domain-containing protein and winged-helix DNA-binding domain-containing protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3357943 - 3358620 bp
Length : 678 bp
Strand : -
Note : PFAM: Transcriptional regulatory protein, C terminal; Response regulator receiver domain

DNA sequence :
ATGAAGGCGCGTGTGCTGGTCGTTGATGACGACCCCGCTCTGGCTGAAATGCTCACCATCGTGCTGCGCGGCGAGGGGTT
CGACACCGCCGTGGTGTCCGATGGTTCTCGTGCACTGCCTGCGCTGCGCGAACTCAAACCCGACCTGGTCCTGCTCGACC
TCATGCTGCCCGGCATGAACGGCATCGACGTCTGCAAGGCGATCCGAGCAGAATCCGGCGTGCCGATCGTGATGCTCACG
GCGAAGAGCGACACCGTGGACATCGTGCTGGGTTTGGAGTCGGGCGCCGACGACTACGTCGTCAAGCCGTTCAAACCGAA
GGAACTCGTCGCGCGGGTGCGGGCGCGGTTGCGGCGCACCGAGTCCGAGCCCGCCGAGACGCTCACCATCGGTGACCTCA
CCATCGACGTGCCGGGGCACGAGGTCACGAGGGACGGCAAGGCCATCCCCCTAACCCCGTTGGAGTTCGACCTGCTCGTG
GCACTGGCCCGCAAGCCGCGACAGGTCTTCACCCGTGAGGTCCTGCTCGAACAGGTCTGGGGTTATCGGCATGCGGCCGA
TACGCGGCTGGTCAACGTGCACGTTCAGCGACTGCGGTCGAAGGTCGAGAAGGATCCTGAGCATCCCGAGGTCGTGCTGA
CCGTCCGCGGCGTCGGTTACAAAGCGGGTCCCCCGTAA

Protein sequence :
MKARVLVVDDDPALAEMLTIVLRGEGFDTAVVSDGSRALPALRELKPDLVLLDLMLPGMNGIDVCKAIRAESGVPIVMLT
AKSDTVDIVLGLESGADDYVVKPFKPKELVARVRARLRRTESEPAETLTIGDLTIDVPGHEVTRDGKAIPLTPLEFDLLV
ALARKPRQVFTREVLLEQVWGYRHAADTRLVNVHVQRLRSKVEKDPEHPEVVLTVRGVGYKAGPP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-31 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 4e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Svir_30940 YP_003134896.1 response regulator with CheY-like receiver domain-containing protein and winged-helix DNA-binding domain-containing protein AE000516.2.gene3505. Protein 9e-78 83
Svir_30940 YP_003134896.1 response regulator with CheY-like receiver domain-containing protein and winged-helix DNA-binding domain-containing protein NC_002952.2859905.p0 Protein 6e-38 46
Svir_30940 YP_003134896.1 response regulator with CheY-like receiver domain-containing protein and winged-helix DNA-binding domain-containing protein NC_002951.3237708.p0 Protein 6e-38 46
Svir_30940 YP_003134896.1 response regulator with CheY-like receiver domain-containing protein and winged-helix DNA-binding domain-containing protein NC_002758.1121668.p0 Protein 6e-38 46
Svir_30940 YP_003134896.1 response regulator with CheY-like receiver domain-containing protein and winged-helix DNA-binding domain-containing protein NC_003923.1003749.p0 Protein 5e-38 46
Svir_30940 YP_003134896.1 response regulator with CheY-like receiver domain-containing protein and winged-helix DNA-binding domain-containing protein NC_009641.5332272.p0 Protein 6e-38 46
Svir_30940 YP_003134896.1 response regulator with CheY-like receiver domain-containing protein and winged-helix DNA-binding domain-containing protein NC_013450.8614421.p0 Protein 6e-38 46
Svir_30940 YP_003134896.1 response regulator with CheY-like receiver domain-containing protein and winged-helix DNA-binding domain-containing protein NC_007793.3914279.p0 Protein 6e-38 46
Svir_30940 YP_003134896.1 response regulator with CheY-like receiver domain-containing protein and winged-helix DNA-binding domain-containing protein NC_007622.3794472.p0 Protein 6e-38 46
Svir_30940 YP_003134896.1 response regulator with CheY-like receiver domain-containing protein and winged-helix DNA-binding domain-containing protein NC_002745.1124361.p0 Protein 6e-38 46
Svir_30940 YP_003134896.1 response regulator with CheY-like receiver domain-containing protein and winged-helix DNA-binding domain-containing protein NC_009782.5559369.p0 Protein 6e-38 46
Svir_30940 YP_003134896.1 response regulator with CheY-like receiver domain-containing protein and winged-helix DNA-binding domain-containing protein BAC0125 Protein 2e-29 46
Svir_30940 YP_003134896.1 response regulator with CheY-like receiver domain-containing protein and winged-helix DNA-binding domain-containing protein NC_012469.1.7686381. Protein 1e-37 45
Svir_30940 YP_003134896.1 response regulator with CheY-like receiver domain-containing protein and winged-helix DNA-binding domain-containing protein NC_012469.1.7685629. Protein 1e-33 45
Svir_30940 YP_003134896.1 response regulator with CheY-like receiver domain-containing protein and winged-helix DNA-binding domain-containing protein HE999704.1.gene2815. Protein 2e-34 44
Svir_30940 YP_003134896.1 response regulator with CheY-like receiver domain-containing protein and winged-helix DNA-binding domain-containing protein CP000675.2.gene1535. Protein 5e-28 42
Svir_30940 YP_003134896.1 response regulator with CheY-like receiver domain-containing protein and winged-helix DNA-binding domain-containing protein BAC0197 Protein 1e-24 42
Svir_30940 YP_003134896.1 response regulator with CheY-like receiver domain-containing protein and winged-helix DNA-binding domain-containing protein CP001918.1.gene3444. Protein 3e-30 42
Svir_30940 YP_003134896.1 response regulator with CheY-like receiver domain-containing protein and winged-helix DNA-binding domain-containing protein BAC0596 Protein 2e-30 42
Svir_30940 YP_003134896.1 response regulator with CheY-like receiver domain-containing protein and winged-helix DNA-binding domain-containing protein BAC0039 Protein 2e-30 42
Svir_30940 YP_003134896.1 response regulator with CheY-like receiver domain-containing protein and winged-helix DNA-binding domain-containing protein CP001138.1.gene2239. Protein 2e-30 42
Svir_30940 YP_003134896.1 response regulator with CheY-like receiver domain-containing protein and winged-helix DNA-binding domain-containing protein CP000034.1.gene2186. Protein 2e-30 42
Svir_30940 YP_003134896.1 response regulator with CheY-like receiver domain-containing protein and winged-helix DNA-binding domain-containing protein AE015929.1.gene1106. Protein 1e-25 41
Svir_30940 YP_003134896.1 response regulator with CheY-like receiver domain-containing protein and winged-helix DNA-binding domain-containing protein BAC0111 Protein 7e-23 41
Svir_30940 YP_003134896.1 response regulator with CheY-like receiver domain-containing protein and winged-helix DNA-binding domain-containing protein AE016830.1.gene1681. Protein 8e-37 41
Svir_30940 YP_003134896.1 response regulator with CheY-like receiver domain-containing protein and winged-helix DNA-binding domain-containing protein BAC0533 Protein 1e-20 41
Svir_30940 YP_003134896.1 response regulator with CheY-like receiver domain-containing protein and winged-helix DNA-binding domain-containing protein CP000647.1.gene4257. Protein 1e-20 41
Svir_30940 YP_003134896.1 response regulator with CheY-like receiver domain-containing protein and winged-helix DNA-binding domain-containing protein AF155139.2.orf0.gene Protein 1e-27 41
Svir_30940 YP_003134896.1 response regulator with CheY-like receiver domain-containing protein and winged-helix DNA-binding domain-containing protein BAC0308 Protein 3e-23 41
Svir_30940 YP_003134896.1 response regulator with CheY-like receiver domain-containing protein and winged-helix DNA-binding domain-containing protein NC_002695.1.916589.p Protein 5e-30 41
Svir_30940 YP_003134896.1 response regulator with CheY-like receiver domain-containing protein and winged-helix DNA-binding domain-containing protein CP000647.1.gene2531. Protein 4e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Svir_30940 YP_003134896.1 response regulator with CheY-like receiver domain-containing protein and winged-helix DNA-binding domain-containing protein VFG1389 Protein 1e-25 46
Svir_30940 YP_003134896.1 response regulator with CheY-like receiver domain-containing protein and winged-helix DNA-binding domain-containing protein VFG1390 Protein 1e-28 43
Svir_30940 YP_003134896.1 response regulator with CheY-like receiver domain-containing protein and winged-helix DNA-binding domain-containing protein VFG1702 Protein 9e-32 42
Svir_30940 YP_003134896.1 response regulator with CheY-like receiver domain-containing protein and winged-helix DNA-binding domain-containing protein VFG1563 Protein 2e-31 41