Gene Information

Name : Cpin_1169 (Cpin_1169)
Accession : YP_003120868.1
Strain : Chitinophaga pinensis DSM 2588
Genome accession: NC_013132
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 1391787 - 1392341 bp
Length : 555 bp
Strand : +
Note : PFAM: stress protein; KEGG: hso:HS_0633 stress response protein

DNA sequence :
ATGGCAATCAATCTGCAAAAAGGAGAAAGAGCCAATATCGAATTACCAAAATTCACTATTGGCTTAGGATGGGATATCAA
TGAATCACATACAGGCGGAGAATGTGACCTGGATGCTTCTGTATTTCTCTTAGGTGAAAACAGGAAGATCATATCAGATC
CGTATTTCGTGTTTTATAACAACCTGGAATCTCCTGATGGCGCTGTAAAACATTCCGGCGACAACCGTACTGGCGCCGGT
GATGGCGATGATGAAACCATCCATGTAGACCTCTCTGTTATTAACCCTGCTGTAAAAGAAATCTGTGTGGTTGTTACCAT
TCATGAAGCAGCTGCGCGTAAACAGAATTTTGGTCAGATCCGCAATTCATTTATCCGCATTTATGATGCTGCGAAAAATG
TAGAGCTGGTGAAATATGAACTGGGAGAAGATTTCTCTATCGAGACTTCAGTTGAATTCGGCCGTATCTACAAACGCGAA
AACCAATGGCGTTTTGAAGCGGTAGGTATTGGACAGAGCGGCGGACTGGAACAGTTCCTTTCAAAATACGCTTAA

Protein sequence :
MAINLQKGERANIELPKFTIGLGWDINESHTGGECDLDASVFLLGENRKIISDPYFVFYNNLESPDGAVKHSGDNRTGAG
DGDDETIHVDLSVINPAVKEICVVVTIHEAAARKQNFGQIRNSFIRIYDAAKNVELVKYELGEDFSIETSVEFGRIYKRE
NQWRFEAVGIGQSGGLEQFLSKYA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-40 49
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-37 47
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-37 47
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-37 47
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-35 46
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-37 45
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-37 45
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 3e-37 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cpin_1169 YP_003120868.1 stress protein BAC0390 Protein 3e-39 49
Cpin_1169 YP_003120868.1 stress protein BAC0389 Protein 5e-38 44