Gene Information

Name : Caci_8215 (Caci_8215)
Accession : YP_003118879.1
Strain : Catenulispora acidiphila DSM 44928
Genome accession: NC_013131
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 9527020 - 9527700 bp
Length : 681 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: sgr:SGR_4009 two-component system response regulator

DNA sequence :
GTGACCCGTGTACTCGTGGTCGAGGACGAGGACTCGATCAGCGACCCCCTGTCCTACATGCTGCGCAACGAGGGCTTCGA
GGTGGCGGTCGCCGACACCGGCCCGGCCGCGCTGGAGGAGTTCGACCGGCACGGCGCCGACCTGGTGCTGCTGGACCTGA
TGCTGCCCGGGCTGCCCGGGACCGAGGTCTGCCGGCAGATCCGGGCCAAGTCCAACGTCCCGGTGATCATGCTGACCGCC
AAGGACAGCGAGATCGACAAGGTCGTCGGCCTGGAGCTGGGCGCCGACGACTACGTCACCAAGCCTTTCTCGGCCCGCGA
ACTGGTGGCCCGCATCCGTGCGGTGCTGCGCCGGCAGGCGGCCAGCGACGAGCCGGACGGCGGCGCGCTGGAGGCCGGCC
CGGTCCGGATGGACGTGGACCGGCACAAGGTGACGGTCGACGGCCGCCCCGTCGAGCTGCCGCTGAAGGAGTTCGAGCTG
CTGGAGATGCTGCTGCGCAACTCCGGCCGGGTGCTGACCCGGATGCAGCTGATCGACCGGGTGTGGGGCGCGGACTACGT
CGGCGACACCAAGACGCTGGACGTGCACGTCAAGCGCCTGCGCGCGAAGATCGAGCCGGACCCGGGCACGCCGGTGCACC
TGGTGACGGTGCGCGGGCTCGGGTACAAGTTCGAGGGCTGA

Protein sequence :
MTRVLVVEDEDSISDPLSYMLRNEGFEVAVADTGPAALEEFDRHGADLVLLDLMLPGLPGTEVCRQIRAKSNVPVIMLTA
KDSEIDKVVGLELGADDYVTKPFSARELVARIRAVLRRQAASDEPDGGALEAGPVRMDVDRHKVTVDGRPVELPLKEFEL
LEMLLRNSGRVLTRMQLIDRVWGADYVGDTKTLDVHVKRLRAKIEPDPGTPVHLVTVRGLGYKFEG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-25 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Caci_8215 YP_003118879.1 two component transcriptional regulator AE000516.2.gene3505. Protein 1e-35 49
Caci_8215 YP_003118879.1 two component transcriptional regulator NC_012469.1.7685629. Protein 5e-42 47
Caci_8215 YP_003118879.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-41 47
Caci_8215 YP_003118879.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-41 47
Caci_8215 YP_003118879.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-41 47
Caci_8215 YP_003118879.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-41 47
Caci_8215 YP_003118879.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-41 47
Caci_8215 YP_003118879.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-41 47
Caci_8215 YP_003118879.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-41 47
Caci_8215 YP_003118879.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-41 47
Caci_8215 YP_003118879.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-41 47
Caci_8215 YP_003118879.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-41 47
Caci_8215 YP_003118879.1 two component transcriptional regulator HE999704.1.gene2815. Protein 3e-39 46
Caci_8215 YP_003118879.1 two component transcriptional regulator NC_012469.1.7686381. Protein 5e-40 45
Caci_8215 YP_003118879.1 two component transcriptional regulator AE015929.1.gene1106. Protein 2e-30 43
Caci_8215 YP_003118879.1 two component transcriptional regulator HE999704.1.gene1528. Protein 2e-25 43
Caci_8215 YP_003118879.1 two component transcriptional regulator AE016830.1.gene1681. Protein 2e-43 43
Caci_8215 YP_003118879.1 two component transcriptional regulator BAC0308 Protein 2e-26 42
Caci_8215 YP_003118879.1 two component transcriptional regulator BAC0083 Protein 5e-31 42
Caci_8215 YP_003118879.1 two component transcriptional regulator BAC0125 Protein 1e-28 42
Caci_8215 YP_003118879.1 two component transcriptional regulator BAC0638 Protein 5e-22 42
Caci_8215 YP_003118879.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-32 41
Caci_8215 YP_003118879.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-32 41
Caci_8215 YP_003118879.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-32 41
Caci_8215 YP_003118879.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-32 41
Caci_8215 YP_003118879.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-32 41
Caci_8215 YP_003118879.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-32 41
Caci_8215 YP_003118879.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-32 41
Caci_8215 YP_003118879.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-32 41
Caci_8215 YP_003118879.1 two component transcriptional regulator BAC0347 Protein 1e-25 41
Caci_8215 YP_003118879.1 two component transcriptional regulator BAC0197 Protein 1e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Caci_8215 YP_003118879.1 two component transcriptional regulator VFG1386 Protein 9e-29 43
Caci_8215 YP_003118879.1 two component transcriptional regulator VFG1390 Protein 3e-33 42
Caci_8215 YP_003118879.1 two component transcriptional regulator VFG1389 Protein 6e-29 42
Caci_8215 YP_003118879.1 two component transcriptional regulator VFG0596 Protein 5e-26 42