Gene Information

Name : Caci_7594 (Caci_7594)
Accession : YP_003118259.1
Strain : Catenulispora acidiphila DSM 44928
Genome accession: NC_013131
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 8806567 - 8807253 bp
Length : 687 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: sco:SCO3013 two-component system response regulator

DNA sequence :
ATGGTCCGCATGAAAGGTCGTGTGCTCATCGTCGACGATGACATAGCCCTGTCCGAGATGCTGGGCATCGCCCTGCGCGG
CGAGGGTTTCGAGACCACGTCCGTCGCCGACGGCGACCGGGCCCTGCAGGTGTTCCGCGACTTCAAGCCGGACCTGGTAC
TGCTGGACCTGATGTTGCCCGGGCGCGACGGGATCGACGTGTGCCGGCTGATCCGCGGCGAGTCCGGGGTCCCGATCATC
ATGCTCACCGCCAAGAGCGACACGGTCGACGTCGTCGTCGGCCTGGAGTCCGGCGCGGACGACTACGTGATCAAGCCGTT
CAAGGTCAAGGAGCTGGTGGCGCGGGTGCGCGCCCGGCTGCGCCGCGCCGACGAGCCCAAGCCCGAGACGCTGGCCATCG
GCGATCTGTCGATCGACGTGGCCGGCCACTCGGTCAAGCGTGAGGGCCGGCAGATCCCGCTCACGCCGCTGGAGTTCGAC
CTGCTGGTCGCCCTGGCGCGCAAGCCCTGGCAGGTGTTCACCCGCGAGGTGCTGCTGGAGCAGGTCTGGGGCTACCGGCA
CGCCGCCGACACCCGGCTGGTGAACGTGCACGTGCAGCGGCTGCGCAGCAAGATCGAGGTCGACCCGGAGAATCCGGAGA
TCGTGGTCACCGTGCGCGGAGTGGGTTACAAAGCCGGTCCGGCTTAA

Protein sequence :
MVRMKGRVLIVDDDIALSEMLGIALRGEGFETTSVADGDRALQVFRDFKPDLVLLDLMLPGRDGIDVCRLIRGESGVPII
MLTAKSDTVDVVVGLESGADDYVIKPFKVKELVARVRARLRRADEPKPETLAIGDLSIDVAGHSVKREGRQIPLTPLEFD
LLVALARKPWQVFTREVLLEQVWGYRHAADTRLVNVHVQRLRSKIEVDPENPEIVVTVRGVGYKAGPA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-34 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Caci_7594 YP_003118259.1 two component transcriptional regulator AE000516.2.gene3505. Protein 1e-77 73
Caci_7594 YP_003118259.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 7e-38 45
Caci_7594 YP_003118259.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-37 45
Caci_7594 YP_003118259.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-37 45
Caci_7594 YP_003118259.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-37 45
Caci_7594 YP_003118259.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-37 45
Caci_7594 YP_003118259.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 7e-38 45
Caci_7594 YP_003118259.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-37 45
Caci_7594 YP_003118259.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-37 45
Caci_7594 YP_003118259.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-37 45
Caci_7594 YP_003118259.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-37 45
Caci_7594 YP_003118259.1 two component transcriptional regulator NC_012469.1.7685629. Protein 1e-39 44
Caci_7594 YP_003118259.1 two component transcriptional regulator BAC0125 Protein 5e-29 42
Caci_7594 YP_003118259.1 two component transcriptional regulator NC_012469.1.7686381. Protein 5e-35 42
Caci_7594 YP_003118259.1 two component transcriptional regulator HE999704.1.gene1528. Protein 4e-35 42
Caci_7594 YP_003118259.1 two component transcriptional regulator BAC0197 Protein 9e-26 42
Caci_7594 YP_003118259.1 two component transcriptional regulator NC_002695.1.916589.p Protein 4e-32 42
Caci_7594 YP_003118259.1 two component transcriptional regulator BAC0039 Protein 4e-32 42
Caci_7594 YP_003118259.1 two component transcriptional regulator BAC0596 Protein 1e-31 42
Caci_7594 YP_003118259.1 two component transcriptional regulator CP000034.1.gene2186. Protein 4e-32 42
Caci_7594 YP_003118259.1 two component transcriptional regulator CP001138.1.gene2239. Protein 1e-31 42
Caci_7594 YP_003118259.1 two component transcriptional regulator AE015929.1.gene1106. Protein 6e-29 41
Caci_7594 YP_003118259.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 4e-34 41
Caci_7594 YP_003118259.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 4e-34 41
Caci_7594 YP_003118259.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 4e-34 41
Caci_7594 YP_003118259.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 4e-34 41
Caci_7594 YP_003118259.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 4e-34 41
Caci_7594 YP_003118259.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 4e-34 41
Caci_7594 YP_003118259.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 4e-34 41
Caci_7594 YP_003118259.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 4e-34 41
Caci_7594 YP_003118259.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 7e-30 41
Caci_7594 YP_003118259.1 two component transcriptional regulator CP001918.1.gene3444. Protein 1e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Caci_7594 YP_003118259.1 two component transcriptional regulator VFG1389 Protein 1e-27 43
Caci_7594 YP_003118259.1 two component transcriptional regulator VFG1390 Protein 2e-31 42
Caci_7594 YP_003118259.1 two component transcriptional regulator VFG1702 Protein 1e-34 41