Gene Information

Name : Caci_0208 (Caci_0208)
Accession : YP_003111004.1
Strain : Catenulispora acidiphila DSM 44928
Genome accession: NC_013131
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 225750 - 226466 bp
Length : 717 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: fre:Franean1_5311 two component transcriptional regulator

DNA sequence : 
ATGGACACCCGAGGCTCCCTAGACCGAGAACCGCGCAGCCTGCTGGTCGTCGACGACGACACCGAGATCCGTGACGCGAT
CGCACGGGCCTTCCGCCTGCAGGGCTATCGCGTGCGCACCGCTTCCGGCGGCCTGGCCGCCCTGGAGCAGGTCGCGGCCG
ACCCGCCGGACGCGATCGTGCTGGACGTGATGATGCCCGAGCTCGACGGGGTGGAGGTGTGCCGGCGCCTGCGCGGCGTC
GGCGACCACACCCCGGTGCTGCTGCTGACCGCGCGCGACGCGGTCGGGGACCGGGTGGCCGGGCTCGACGCCGGCGCCGA
CGACTACCTGGTGAAGCCGTTCGCGCTGGCCGAGCTGCACGCCCGGATGCGCGCGCTGCTGCGCCGCTCCGAGTACGACC
CGGTGCCCGAATCCGAGCGCCTGGTGTTCGAGGACCTGGAGCTGGACCCCGAGTCCCGGCTGGCCTACCGCGGCGGGCGC
ACGATCGAGCTGACCCGCACCGAGTTCGCGCTGCTGGAGCTCCTGATGCGCAACGCGGGGCGGGTGCTGCCCCGGGAAGT
GATCTCCGACCGGATCTGGGGCTACGAACTCGGGCCGGAGTCGAACTCCCTGGAGGTGTTCGTGTCCTGCATCCGGCGCA
AGACGGAGGGCGGGGGAGAGCCCCGGCTGGTGCAGACGGTGCGCGGCTTCGGGTACACGCTGCGGGTGCCGGCGTGA

Protein sequence : 
MDTRGSLDREPRSLLVVDDDTEIRDAIARAFRLQGYRVRTASGGLAALEQVAADPPDAIVLDVMMPELDGVEVCRRLRGV
GDHTPVLLLTARDAVGDRVAGLDAGADDYLVKPFALAELHARMRALLRRSEYDPVPESERLVFEDLELDPESRLAYRGGR
TIELTRTEFALLELLMRNAGRVLPREVISDRIWGYELGPESNSLEVFVSCIRRKTEGGGEPRLVQTVRGFGYTLRVPA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-35 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Caci_0208 YP_003111004.1 two component transcriptional regulator BAC0083 Protein 3e-42 47
Caci_0208 YP_003111004.1 two component transcriptional regulator HE999704.1.gene1528. Protein 2e-38 44
Caci_0208 YP_003111004.1 two component transcriptional regulator BAC0197 Protein 8e-37 43
Caci_0208 YP_003111004.1 two component transcriptional regulator BAC0125 Protein 3e-37 43
Caci_0208 YP_003111004.1 two component transcriptional regulator BAC0638 Protein 6e-34 43
Caci_0208 YP_003111004.1 two component transcriptional regulator CP001918.1.gene5135. Protein 9e-21 42
Caci_0208 YP_003111004.1 two component transcriptional regulator BAC0347 Protein 1e-36 41
Caci_0208 YP_003111004.1 two component transcriptional regulator BAC0111 Protein 6e-40 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Caci_0208 YP_003111004.1 two component transcriptional regulator VFG1390 Protein 3e-61 60
Caci_0208 YP_003111004.1 two component transcriptional regulator VFG1389 Protein 1e-45 47
Caci_0208 YP_003111004.1 two component transcriptional regulator VFG1386 Protein 6e-46 46
Caci_0208 YP_003111004.1 two component transcriptional regulator VFG0473 Protein 6e-30 42
Caci_0208 YP_003111004.1 two component transcriptional regulator VFG0596 Protein 1e-35 41