Gene Information

Name : Afer_0558 (Afer_0558)
Accession : YP_003109185.1
Strain : Acidimicrobium ferrooxidans DSM 10331
Genome accession: NC_013124
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 561004 - 561717 bp
Length : 714 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: kra:Krad_3036 two component transcriptional regulator

DNA sequence :
ATGGACAGTTTGCGCAAGCCAGCGAAGGGCGTTCGCGTGCTCGTGGTCGACGATGAGCTGCCCATCACCGAGCTCCTGCA
GATGGCGCTCACCTTCGAAGGCTATGACGTGAGCGTCGCTTCGTCCGGCCGCGAGGCTCTCGACGTACTCCGGACCGTGA
AGCCAGACCTGCTCATCCTCGACGTCATGATGCCAGGGATGGATGGCTTCACCCTGCTCCGTCGTCTGCGAGAAGAGCGC
AACGACGTCCCCGTGCTCCTGCTCACCGCGAAGGACGCCGTCGAGGACCGCGTCCAGGGCCTCCAGCTCGGCTCGGACGA
CTACGTCACGAAGCCCTTCTCGTTGGCAGAGCTCGTGGCGCGCGTCGAGGCGATCCTGCGACGCTCCGGCCAGGGGACGG
GTGCGCCCACTCGGATCGTCGTCGGCGACCTCGTCCTCGACGAGGATGCCCACCAGGTGCTGCGAGCGGGACACGAGATC
GAGCTCACGGCGACCGAGTTCAAGCTGCTGCGCTACCTCATGCTGAACGCGAACAAGGTGGTCTCCAAGGCGCAGATCCT
CGACCACGTCTGGCAGTACGACTTCGGCGGCGACGCAAACATCGTGGAGACCTACATCTCGTATCTGCGCAAGAAGCTCG
ACGGCTACGGTCCACCGATGATCAAGACCGTCCGCGGCGTCGGCTACTCCCTCCGTGCGGCGGAGTCGGCGTAG

Protein sequence :
MDSLRKPAKGVRVLVVDDELPITELLQMALTFEGYDVSVASSGREALDVLRTVKPDLLILDVMMPGMDGFTLLRRLREER
NDVPVLLLTAKDAVEDRVQGLQLGSDDYVTKPFSLAELVARVEAILRRSGQGTGAPTRIVVGDLVLDEDAHQVLRAGHEI
ELTATEFKLLRYLMLNANKVVSKAQILDHVWQYDFGGDANIVETYISYLRKKLDGYGPPMIKTVRGVGYSLRAAESA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-37 42
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 3e-33 41
mprA YP_005682550.1 response regulator mprA Not tested PiCp 3 Protein 3e-32 41
tcsR1 YP_003782583.1 two-component system transcriptional regulatory protein Not tested PiCp 3 Protein 3e-32 41
mprA YP_005684640.1 response regulator mprA Not tested PiCp 3 Protein 3e-32 41
mprA YP_005680459.1 response regulator mprA Not tested PiCp 3 Protein 3e-32 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Afer_0558 YP_003109185.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-43 47
Afer_0558 YP_003109185.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-43 47
Afer_0558 YP_003109185.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-43 47
Afer_0558 YP_003109185.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-43 47
Afer_0558 YP_003109185.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-43 47
Afer_0558 YP_003109185.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-43 47
Afer_0558 YP_003109185.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-43 47
Afer_0558 YP_003109185.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-43 47
Afer_0558 YP_003109185.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-43 47
Afer_0558 YP_003109185.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-43 47
Afer_0558 YP_003109185.1 winged helix family two component transcriptional regulator BAC0197 Protein 8e-39 46
Afer_0558 YP_003109185.1 winged helix family two component transcriptional regulator BAC0083 Protein 4e-40 45
Afer_0558 YP_003109185.1 winged helix family two component transcriptional regulator BAC0638 Protein 4e-37 44
Afer_0558 YP_003109185.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-40 43
Afer_0558 YP_003109185.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-40 43
Afer_0558 YP_003109185.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-40 43
Afer_0558 YP_003109185.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-40 43
Afer_0558 YP_003109185.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-40 43
Afer_0558 YP_003109185.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-40 43
Afer_0558 YP_003109185.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-40 43
Afer_0558 YP_003109185.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-40 43
Afer_0558 YP_003109185.1 winged helix family two component transcriptional regulator BAC0125 Protein 2e-39 43
Afer_0558 YP_003109185.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 2e-42 43
Afer_0558 YP_003109185.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 8e-35 42
Afer_0558 YP_003109185.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 3e-38 42
Afer_0558 YP_003109185.1 winged helix family two component transcriptional regulator CP000034.1.gene3834. Protein 5e-25 42
Afer_0558 YP_003109185.1 winged helix family two component transcriptional regulator NC_002695.1.915041.p Protein 5e-25 42
Afer_0558 YP_003109185.1 winged helix family two component transcriptional regulator BAC0308 Protein 1e-38 42
Afer_0558 YP_003109185.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 9e-36 41
Afer_0558 YP_003109185.1 winged helix family two component transcriptional regulator BAC0533 Protein 5e-24 41
Afer_0558 YP_003109185.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 8e-42 41
Afer_0558 YP_003109185.1 winged helix family two component transcriptional regulator CP000647.1.gene4257. Protein 5e-24 41
Afer_0558 YP_003109185.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 3e-24 41
Afer_0558 YP_003109185.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 1e-33 41
Afer_0558 YP_003109185.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 4e-20 41
Afer_0558 YP_003109185.1 winged helix family two component transcriptional regulator AF162694.1.orf4.gene Protein 3e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Afer_0558 YP_003109185.1 winged helix family two component transcriptional regulator VFG1386 Protein 3e-64 55
Afer_0558 YP_003109185.1 winged helix family two component transcriptional regulator VFG1390 Protein 2e-49 46
Afer_0558 YP_003109185.1 winged helix family two component transcriptional regulator VFG1389 Protein 3e-43 46
Afer_0558 YP_003109185.1 winged helix family two component transcriptional regulator VFG0596 Protein 3e-37 42