Gene Information

Name : Afer_0200 (Afer_0200)
Accession : YP_003108842.1
Strain : Acidimicrobium ferrooxidans DSM 10331
Genome accession: NC_013124
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 205042 - 205770 bp
Length : 729 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: mab:MAB_4047c sensory transduction protein RegX3

DNA sequence :
ATGGCCGCTGACGACAAGCGCGCCCACGTCGGCACGGTGCTGATCGCCGACGACGAACCGAGCTTCGTCGAGGCCCTCGT
CCTCGGCCTGACGCGCGAAGGCTTCGAGACGATCGTGGCCAACGACGGCGAAGAGGCGCTGGCGTTGAGTCGCTCGCACC
ATCCCGACCTCATCCTGCTCGATGTGATGCTGCCGCGCCTGTCAGGGCTCGACGTCTGTCGCACCATTCGACAGGAGTCC
TCGGTCCCGATCATCATGGTGACGGCACGTTCCGGTGAGCTCGACACCGTGCTCGGCCTCGAACTCGGCGCCGACGACTA
CGTCACCAAGCCGTTTCGCATGAGCGAGCTGGTCGCCAGGATCCGTGCGCAGATGCGCCGCACCAAGCACCAGGGCCAAG
CCCAGGCCGCAGAGGAGATCCTCGAGAGCCACGGCATCACCGTGTACGTCGATCGCCACCAAGTCGATGTCCGAGGGACC
GAGGTCCGCCTGCCTCCGAAGGAGTTCGATCTCCTCTTGCTGTTCCTGCGCAACCCCGGCCGCGTGCTCACGCGCGATCT
GATCCTCGACCGAGTCTGGGGGTCGGACTACTACGGCGACACGAAGACGCTCGACGTGCACGTCAAGCGCCTTCGCTCCA
AGATCGAGCCAGATCCCAACAACCCGAGCATCATCGCCACGGTACGAGGGGTCGGCTACCGGCTCGAACGAGACCACGCC
CGTGCCTGA

Protein sequence :
MAADDKRAHVGTVLIADDEPSFVEALVLGLTREGFETIVANDGEEALALSRSHHPDLILLDVMLPRLSGLDVCRTIRQES
SVPIIMVTARSGELDTVLGLELGADDYVTKPFRMSELVARIRAQMRRTKHQGQAQAAEEILESHGITVYVDRHQVDVRGT
EVRLPPKEFDLLLLFLRNPGRVLTRDLILDRVWGSDYYGDTKTLDVHVKRLRSKIEPDPNNPSIIATVRGVGYRLERDHA
RA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-42 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-41 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Afer_0200 YP_003108842.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-48 47
Afer_0200 YP_003108842.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-48 47
Afer_0200 YP_003108842.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 8e-49 47
Afer_0200 YP_003108842.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-48 47
Afer_0200 YP_003108842.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-48 47
Afer_0200 YP_003108842.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-48 47
Afer_0200 YP_003108842.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-48 47
Afer_0200 YP_003108842.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-48 47
Afer_0200 YP_003108842.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-48 46
Afer_0200 YP_003108842.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 2e-46 46
Afer_0200 YP_003108842.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-48 46
Afer_0200 YP_003108842.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 2e-44 45
Afer_0200 YP_003108842.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 6e-46 45
Afer_0200 YP_003108842.1 winged helix family two component transcriptional regulator BAC0111 Protein 3e-36 44
Afer_0200 YP_003108842.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 5e-49 44
Afer_0200 YP_003108842.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-41 43
Afer_0200 YP_003108842.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-41 43
Afer_0200 YP_003108842.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-41 43
Afer_0200 YP_003108842.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-41 43
Afer_0200 YP_003108842.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-41 43
Afer_0200 YP_003108842.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-41 43
Afer_0200 YP_003108842.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-41 43
Afer_0200 YP_003108842.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-41 43
Afer_0200 YP_003108842.1 winged helix family two component transcriptional regulator BAC0197 Protein 1e-32 43
Afer_0200 YP_003108842.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 8e-35 42
Afer_0200 YP_003108842.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 9e-35 42
Afer_0200 YP_003108842.1 winged helix family two component transcriptional regulator BAC0308 Protein 2e-33 41
Afer_0200 YP_003108842.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 1e-45 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Afer_0200 YP_003108842.1 winged helix family two component transcriptional regulator VFG1563 Protein 8e-43 42
Afer_0200 YP_003108842.1 winged helix family two component transcriptional regulator VFG1390 Protein 5e-36 42
Afer_0200 YP_003108842.1 winged helix family two component transcriptional regulator VFG1702 Protein 6e-42 41