Gene Information

Name : Amir_5491 (Amir_5491)
Accession : YP_003103155.1
Strain : Actinosynnema mirum DSM 43827
Genome accession: NC_013093
Putative virulence/resistance : Resistance
Product : ArsR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0640
EC number : -
Position : 6524354 - 6524653 bp
Length : 300 bp
Strand : +
Note : PFAM: regulatory protein ArsR; SMART: regulatory protein ArsR; KEGG: bpt:Bpet3500 ArsR family transcriptional regulator

DNA sequence : 
ATGTTCGCCGTGCTGGCCGACTCCCACCGGCGGGAGATCCTCGACGTCCTGCGGTCAGGCGAGCGCCCGGTCAACGACCT
GGTCGAGCTGCTCAACCTGACCCAGCCCACGGTGTCCAAGCACCTCAAGGTGCTTCGCGACGTGGGGCTGGTCGAGGTCC
GCAGGGACGCCCAGCGGCGCTGGTACCGGCTCCAGCCGGAGCCGCTGGCGGAGGTCGACGCCTGGCTCGCCCCGTACCGG
CGGATGTGGATGACGAGCTTCACCGCTCTCGACCGGCACCTGGAGGAGATGGGCGAATGA

Protein sequence : 
MFAVLADSHRREILDVLRSGERPVNDLVELLNLTQPTVSKHLKVLRDVGLVEVRRDAQRRWYRLQPEPLAEVDAWLAPYR
RMWMTSFTALDRHLEEMGE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
arsR YP_252025.1 arsenical resistance operon repressor Not tested SCCmec Protein 1e-12 42
arsR YP_005754066.1 arsenical resistance operon repressor Not tested Type-XI SCCmec Protein 2e-09 41
arsR YP_252018.1 arsenical resistance operon repressor Not tested SCCmec Protein 5e-11 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Amir_5491 YP_003103155.1 ArsR family transcriptional regulator BAC0592 Protein 9e-10 41