Gene Information

Name : Amir_2632 (Amir_2632)
Accession : YP_003100413.1
Strain : Actinosynnema mirum DSM 43827
Genome accession: NC_013093
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2964260 - 2964949 bp
Length : 690 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: sfu:Sfum_2007 two component transcriptional regulator, winged helix family

DNA sequence :
GTGCACATCCTGGTCGTGGACGACGAGGTCGCGGTCGCCGAGGCCGTGACGCGCACGCTGCGTTTCGAGGGCTACGAGGT
CACGACCGCGCACGACGGGGCCCAGGCGCTCGACCTCGTGCGCTCCCTGCGCCCCGACGGGGTGATACTCGACGTGACCA
TGCCGGTGCTCGGCGGACTCGACGCGTGCCGCGCGCTGCGCGCCTCCGGCGACACCACCCCGGTGCTCATGCTGACCGCC
CGCGCGGAGGTCTCCGACCGGGTCGCGGGCCTGGACGCGGGCGCCGACGACTACCTCGCCAAGCCGTTCGCGCTCCAGGA
GCTGCTGGCCAGGGTGCGCGCGCTGGTGCGGCGCGGCGGCTACGCGGGCACCGCGGCCCGCTCGGAGGCGCTGCGCTTCG
CCGACCTGCTGCTCGACGCGGGCACCCGCGAGGTGCGGCGGGGAGACCGGCAGGTGGCCCTGACCAGGACCGAGTTCTCG
ATCCTGGAGACGTTCCTGCGCAACCCGAGGCTGGTGCTGTCCAGGGAGGCGATGTTCCGCACCGTGTGGGGCCACGACTT
CGGCGCGGGCTCCAACGGCCTCGACGTGTACGTCGGCTACCTGCGCCGCAAGCTGGAGCAGGACGGCGAGCCGCGCCTGA
TCCACACCGTGCGCGGCGTGGGCTACGTGCTCCGCGAGGACCCGCTGTGA

Protein sequence :
MHILVVDDEVAVAEAVTRTLRFEGYEVTTAHDGAQALDLVRSLRPDGVILDVTMPVLGGLDACRALRASGDTTPVLMLTA
RAEVSDRVAGLDAGADDYLAKPFALQELLARVRALVRRGGYAGTAARSEALRFADLLLDAGTREVRRGDRQVALTRTEFS
ILETFLRNPRLVLSREAMFRTVWGHDFGAGSNGLDVYVGYLRRKLEQDGEPRLIHTVRGVGYVLREDPL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-15 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Amir_2632 YP_003100413.1 winged helix family two component transcriptional regulator BAC0347 Protein 3e-21 45
Amir_2632 YP_003100413.1 winged helix family two component transcriptional regulator BAC0638 Protein 1e-14 45
Amir_2632 YP_003100413.1 winged helix family two component transcriptional regulator BAC0083 Protein 2e-21 44
Amir_2632 YP_003100413.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-25 44
Amir_2632 YP_003100413.1 winged helix family two component transcriptional regulator BAC0125 Protein 1e-21 43
Amir_2632 YP_003100413.1 winged helix family two component transcriptional regulator BAC0111 Protein 7e-23 43
Amir_2632 YP_003100413.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 9e-32 43
Amir_2632 YP_003100413.1 winged helix family two component transcriptional regulator BAC0308 Protein 2e-20 43
Amir_2632 YP_003100413.1 winged helix family two component transcriptional regulator BAC0197 Protein 2e-16 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Amir_2632 YP_003100413.1 winged helix family two component transcriptional regulator VFG1390 Protein 7e-51 64
Amir_2632 YP_003100413.1 winged helix family two component transcriptional regulator VFG1389 Protein 1e-34 52
Amir_2632 YP_003100413.1 winged helix family two component transcriptional regulator VFG1386 Protein 6e-37 50
Amir_2632 YP_003100413.1 winged helix family two component transcriptional regulator VFG0596 Protein 5e-16 41