Gene Information

Name : Amir_1933 (Amir_1933)
Accession : YP_003099727.1
Strain : Actinosynnema mirum DSM 43827
Genome accession: NC_013093
Putative virulence/resistance : Resistance
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2146634 - 2147359 bp
Length : 726 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: bcb:BCB4264_A5589 DNA-binding response regulator YycF

DNA sequence :
GTGGGCGGGACCTTCGTCCTGAGCCGGGTGGGGGAAGCTTGGCGGGTGGAGTTCTCGGTACTGCTCGTGGAGGACGACGA
GCACATCAGGCAGGCGCTGGGTCTGGCGCTGGGCGACGAGGGGTTCGGCGTCACCGACGCCGTGTCCGGCGAGGAGGCCC
TGCGCCTTCTGGACCGCCGCGTGTTCGACGTGGTCCTGCTGGACCTGTCGCTGCCCGGCGTGGACGGCCTGGAGGTGTGC
CGGGTCCTGCGGGCGCGCGGCGACCTCCCGATCATCATCGTCACGGCCCGCGCCGACACCGCCGACGTCATCGCGGGACT
GGAGGCGGGCGCCGACGACTACGTGACCAAGCCCCTGGTGGCGGGCGAGCTGGCCGCCCGCATCCGCGCGCTCCTGCGCC
GCCGGGGCGGTGGCGGCGAGGAGGCCCTCCGCTTCGGCGACCTGGAGGTGCGCGCGGGCGAGGGCGTGGTCCTGCGCGCG
GGCGACGAGGTCCACCTGACCCGCACCGAGTTCCGCCTCCTCGTCGAGCTCGCCTCGGCCGCCGGACGCGTCGTCACCAG
GGAGCAGCTCCTCCAGCGCGTCTGGGGCTACGACTACTTCGGCGACACCCGCCTCCTGGACGTGCACATCCGCAGGCTGC
GCCGCAAGGTCGAGCAGAACCCCGACGACCCCGCCCTCGTCCTCACCGTGCGCGGCGCGGGCTACCGCCTAGACCCCGAC
CAGTGA

Protein sequence :
MGGTFVLSRVGEAWRVEFSVLLVEDDEHIRQALGLALGDEGFGVTDAVSGEEALRLLDRRVFDVVLLDLSLPGVDGLEVC
RVLRARGDLPIIIVTARADTADVIAGLEAGADDYVTKPLVAGELAARIRALLRRRGGGGEEALRFGDLEVRAGEGVVLRA
GDEVHLTRTEFRLLVELASAAGRVVTREQLLQRVWGYDYFGDTRLLDVHIRRLRRKVEQNPDDPALVLTVRGAGYRLDPD
Q

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 4e-22 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 8e-22 42
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 9e-23 41
EF0571 NP_814337.1 DNA-binding response regulator Not tested Not named Protein 3e-24 41
ef0091 AAM75294.1 EF0091 Not tested Not named Protein 2e-24 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Amir_1933 YP_003099727.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 3e-36 48
Amir_1933 YP_003099727.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 2e-28 45
Amir_1933 YP_003099727.1 winged helix family two component transcriptional regulator AF310956.2.orf0.gene Protein 4e-23 41
Amir_1933 YP_003099727.1 winged helix family two component transcriptional regulator BAC0125 Protein 5e-21 41
Amir_1933 YP_003099727.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-23 41
Amir_1933 YP_003099727.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-23 41
Amir_1933 YP_003099727.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-23 41
Amir_1933 YP_003099727.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-23 41
Amir_1933 YP_003099727.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-23 41
Amir_1933 YP_003099727.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-23 41
Amir_1933 YP_003099727.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-23 41
Amir_1933 YP_003099727.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-23 41
Amir_1933 YP_003099727.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 5e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Amir_1933 YP_003099727.1 winged helix family two component transcriptional regulator VFG1389 Protein 3e-19 43
Amir_1933 YP_003099727.1 winged helix family two component transcriptional regulator VFG1390 Protein 1e-25 42
Amir_1933 YP_003099727.1 winged helix family two component transcriptional regulator VFG1563 Protein 2e-22 42
Amir_1933 YP_003099727.1 winged helix family two component transcriptional regulator VFG1702 Protein 3e-22 42