Gene Information

Name : Dfer_2762 (Dfer_2762)
Accession : YP_003087142.1
Strain : Dyadobacter fermentans DSM 18053
Genome accession: NC_013037
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3416265 - 3416942 bp
Length : 678 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: sfu:Sfum_2007 two component transcriptional regulator, winged helix family

DNA sequence :

ATGAAAATACTTATCGTTGAAGACGAACCGAAACTCGCCGGATTCTTGAAAAGAGGGCTCGAAGAGCAGTCCTGGGAGGT
GGAACTGGCTTATGACGGACAAGTCGGTAAGAAAATGGCTTCCAATTACCGATTCGACGTAATCATCCTGGATGTGAACC
TGCCGCTCCTCAACGGCTACGACCTTGCCAAACAACTCCGCGCCGACGGCCTCACCACCCCGATCCTGTTTCTCACCGCA
TTGGGCACGATCGACGACAAGCTGGACGGTTTCGAAGCCGGTGGGGACGACTACCTCGTCAAACCGTTCGAATTCCGGGA
ACTCATTGCGCGCATCAAAGTCCTTTCGCAGCGCAATAGCGTTCGCGAGCAATCCAGCCAGGTACTCACCCTGGCCGATC
TCGAACTGAACCTCGACGAAAAAGTAGCCCGGAGAGGCGGCAACCGCATTGACCTCACCGCCAAGGAATTCGCATTGCTC
GAATACCTCATGCGCAACCGCGGGCGCGTGGTTTCGCGGGTGGACATTGCCGAGCAGGTGTGGGACATCCGCTTCGATAC
CGGCACCAACGTAATCGACGTTTACATTAATTTTCTCCGCAAAAAAGTCGATAAAGACTATCCTACCAAGCTGATACACA
CAGTGGTAGGTATGGGATATATTTTCAAGGAAGAATGA

Protein sequence :

MKILIVEDEPKLAGFLKRGLEEQSWEVELAYDGQVGKKMASNYRFDVIILDVNLPLLNGYDLAKQLRADGLTTPILFLTA
LGTIDDKLDGFEAGGDDYLVKPFEFRELIARIKVLSQRNSVREQSSQVLTLADLELNLDEKVARRGGNRIDLTAKEFALL
EYLMRNRGRVVSRVDIAEQVWDIRFDTGTNVIDVYINFLRKKVDKDYPTKLIHTVVGMGYIFKEE

• Homologs from PAI DB

Gene	GenBank Accn	Product	Virulance or Resistance	PAI or REI	Alignment Type	E-val	Identity
copR	NP_460069.2	transcriptional regulatory protein YedW	Not tested	SPI-5	Protein	7e-37	41
copR	AAC33719.1	regulatory protein CopR	Not tested	SPI-5	Protein	3e-36	41

• Homologs from CARD and BacMet (resistance genes)

Gene	GenBank Accn	Product	ID of source DB	Alignment Type	E-val	Identity
Dfer_2762	YP_003087142.1	winged helix family two component transcriptional regulator	BAC0125	Protein	4e-48	50
Dfer_2762	YP_003087142.1	winged helix family two component transcriptional regulator	BAC0111	Protein	2e-45	49
Dfer_2762	YP_003087142.1	winged helix family two component transcriptional regulator	BAC0197	Protein	1e-43	49
Dfer_2762	YP_003087142.1	winged helix family two component transcriptional regulator	BAC0083	Protein	7e-46	48
Dfer_2762	YP_003087142.1	winged helix family two component transcriptional regulator	BAC0347	Protein	4e-41	47
Dfer_2762	YP_003087142.1	winged helix family two component transcriptional regulator	BAC0308	Protein	2e-44	46
Dfer_2762	YP_003087142.1	winged helix family two component transcriptional regulator	BAC0638	Protein	6e-38	46
Dfer_2762	YP_003087142.1	winged helix family two component transcriptional regulator	NC_002516.2.879194.p	Protein	9e-29	41

• Homologs from VFDB (virulence genes)

Gene	GenBank Accn	Product	ID of source DB	Alignment Type	E-val	Identity
Dfer_2762	YP_003087142.1	winged helix family two component transcriptional regulator	VFG0596	Protein	3e-37	41
Dfer_2762	YP_003087142.1	winged helix family two component transcriptional regulator	VFG1390	Protein	5e-41	41
Dfer_2762	YP_003087142.1	winged helix family two component transcriptional regulator	VFG1389	Protein	7e-37	41