Gene Information

Name : grlA (ECSP_4692)
Accession : YP_003080489.1
Strain : Escherichia coli TW14359
Genome accession: NC_013008
Putative virulence/resistance : Virulence
Product : LEE-encoded positive regulator of transcription
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4672912 - 4673325 bp
Length : 414 bp
Strand : -
Note : -

DNA sequence :
ATGGAATCTAAAAATAAAAATGGCGACTATGTAATTCCTGACTCAGTAAAGAATTACGATGGTGAACCTCTGTATATCTT
GGTTTCTCTTTGGTGTAAATTGCAGGAGAAATGGATTTCTCGCAATGATATTGCCGAAGCATTCGGTATAAACCTGAGGA
GAGCATCATTTATTATAACTTATATATCGAGAAGAAAAGAAAAAATTTCATTTCGTGTCAGATATGTTAGTTATGGTAAT
TTGCATTATAAGCGCCTTGAGATTTTCATTTATGATGTTAACCTTGAGGCGGTTCCGATAGAAAGTCCTGGAACAACCGG
ACCAAAAAGAAAAACCTACCGAGTTGGTAATGGTATTGTGGGACAGTCTAATATCTGGAACGAAATGATCATGAGGCGGA
AAAAGGAGAGTTAG

Protein sequence :
MESKNKNGDYVIPDSVKNYDGEPLYILVSLWCKLQEKWISRNDIAEAFGINLRRASFIITYISRRKEKISFRVRYVSYGN
LHYKRLEIFIYDVNLEAVPIESPGTTGPKRKTYRVGNGIVGQSNIWNEMIMRRKKES

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
Z5128 NP_290277.1 hypothetical protein Not tested LEE Protein 9e-60 100
ECs4577 NP_312604.1 hypothetical protein Not tested LEE Protein 9e-60 100
unnamed AAC31522.1 L0043 Not tested LEE Protein 7e-60 100
unnamed ACU09467.1 regulatory protein GrlA Virulence LEE Protein 7e-60 100
unnamed AAC38375.1 Orf11 Not tested LEE Protein 2e-59 99
grlA YP_003236097.1 positive regulator GrlA Not tested LEE Protein 3e-59 99
grlA YP_003223484.1 positive regulator GrlA Not tested LEE Protein 1e-58 98
unnamed CAI43883.1 hypothetical protein Not tested LEE Protein 4e-58 98
unnamed AAK26706.1 unknown Not tested LEE Protein 2e-58 97
grlA YP_003232144.1 positive regulator GrlA Not tested LEE Protein 3e-58 97
unnamed AAL57533.1 unknown Not tested LEE Protein 1e-57 97
st15 CAC81853.1 ST15 protein Not tested LEE II Protein 1e-57 97
unnamed AAL06360.1 unknown Not tested LEE Protein 2e-54 92
grlA AFO66330.1 putative LEE-encoded positive regulator of transcription Not tested SESS LEE Protein 2e-39 63
grlA AFO66406.1 putative LEE-encoded positive regulator of transcription Virulence SESS LEE Protein 2e-39 63

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
grlA YP_003080489.1 LEE-encoded positive regulator of transcription VFG0821 Protein 3e-60 100
grlA YP_003080489.1 LEE-encoded positive regulator of transcription VFG0721 Protein 8e-60 99