Gene Information

Name : ECSP_4654 (ECSP_4654)
Accession : YP_003080452.1
Strain : Escherichia coli TW14359
Genome accession: NC_013008
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 4641484 - 4641834 bp
Length : 351 bp
Strand : +
Note : -

DNA sequence :
GTGATATCCTCACCACAACACAAAACAGGTGACTTAATGAACAAGAAAACCAAACGTACTTTCACCCCTGAATTCAGGCT
GGAATGTGCACAGCTAATTGTTGATAAGGGCTACTCATATCGACAAGCCAGTGAAGCGATGAATGTCGGTTCTACCACGC
TTGAGAGTTGGGTGCGCCAGCTCAGGCGAGAGCGTCAGGGGATTGCGCCCTCTGCCACACCTATTACTCCAGACCAGCAA
CGTATCCGCGAACTGGAAAAGCAGGTTCGCCGCCTGGAGGAACACAATACGATATTAAAAAAGGCTACAACCGCGCTCTT
GATGTCCGACTCGCTGAACGGTTCACGATAG

Protein sequence :
MISSPQHKTGDLMNKKTKRTFTPEFRLECAQLIVDKGYSYRQASEAMNVGSTTLESWVRQLRRERQGIAPSATPITPDQQ
RIRELEKQVRRLEEHNTILKKATTALLMSDSLNGSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 2e-44 100
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 2e-50 100
unnamed AAC31483.1 L0004 Not tested LEE Protein 1e-50 100
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 2e-50 100
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 2e-47 97
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 1e-47 97
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-31 64
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 4e-31 64
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-31 64
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 3e-31 64
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-31 64
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-31 64
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-31 64
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 4e-31 64
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 7e-23 60
l7045 CAD33744.1 - Not tested PAI I 536 Protein 4e-23 59
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 4e-23 59
api80 CAF28554.1 putative transposase Not tested YAPI Protein 2e-19 55
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 3e-21 53
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 2e-20 50
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 5e-20 50
tnpA CAB61575.1 transposase A Not tested HPI Protein 1e-19 49

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECSP_4654 YP_003080452.1 hypothetical protein VFG0784 Protein 6e-51 100
ECSP_4654 YP_003080452.1 hypothetical protein VFG1123 Protein 1e-31 64
ECSP_4654 YP_003080452.1 hypothetical protein VFG1485 Protein 2e-23 59
ECSP_4654 YP_003080452.1 hypothetical protein VFG1553 Protein 1e-21 53