Name : rpmG (TERTU_0180) Accession : YP_003071864.1 Strain : Teredinibacter turnerae T7901 Genome accession: NC_012997 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L33 Function : - COG functional category : J : Translation, ribosomal structure and biogenesis COG ID : COG0267 EC number : - Position : 197109 - 197264 bp Length : 156 bp Strand : - Note : in Escherichia coli BM108, a mutation that results in lack of L33 synthesis had no effect on ribosome synthesis or function; there are paralogous genes in several bacterial genomes, and a CXXC motif for zinc binding and an upstream regulation region of th DNA sequence : ATGCGTGACAAGATTCGATTGAACTCAACTGCTGGCACTGGTCACTTCTACACCACTGACAAAAACAAGCGCACCATGCC TGGCAAAATGGAAATTAAAAAGTACGACCCGGTTGTGCGCAAGCACGTGGTCTACAAAGAAGGCAAAATCAAGTAA Protein sequence : MRDKIRLNSTAGTGHFYTTDKNKRTMPGKMEIKKYDPVVRKHVVYKEGKIK |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
ef0106 | AAM75309.1 | EF0106 | Not tested | Not named | Protein | 8e-07 | 41 |
rpmG | NP_814353.1 | 50S ribosomal protein L33 | Not tested | Not named | Protein | 1e-06 | 41 |