Gene Information

Name : Msip34_0398 (Msip34_0398)
Accession : YP_003050173.1
Strain : Methylovorus glucosetrophus SIP3-4
Genome accession: NC_012969
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 409336 - 410016 bp
Length : 681 bp
Strand : -
Note : KEGG: tgr:Tgr7_1208 two component heavy metal response transcriptional regulator, winged helix family; TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver

DNA sequence :
ATGCGAATTCTTGTAGTCGAGGATGAACACAAAACCGGCGAGTATCTGCGCAAAGGCCTGACCGAGGCAGGTTTTGTCAC
GGACCTGATACAGGATGGTCTGGATGGGCAGCATATGGCGCTGGCTGAACATTACGACCTGATCATTCTGGATGTGATGC
TGCCACGCGCCAGTGGCTGGCAGATCATCGCTGCCCTGCGTAAGGCGGGCAAGCATACCCCGGTGCTCTTTCTGACGGCA
CGTGACCTGGTGGAAGACCGCGTGAAAGGCCTGGAACTGGGCGCCGATGACTATCTGGTCAAACCGTTTGCCTTTTCTGA
ATTGCTGGCCCGTATACGCACGCTGTTGCGCCGCGGCAGAACGCGCGAAGCCGATGTGTTGCAGGTCGCCAATCTTGAAG
TCGATGTACTACGGCGGCGCGTGCAGCGCGATGGCAAGAAAATCGAGCTCACGGCCAAGGAGTTTGGGCTACTGGAATTG
CTGGTGCGTCGGCGTGGCGAGGTGTTATCGCGCTCGCTGATTGCCTCCCAAGTATGGGACATGAATTTTGACAGCGACAC
CAATGTGATTGAAGTGGCCATGCGGCGCCTGCGCGCCAAGATTGATGATCCGTTCGAGCCCAAGCTGATTCACACCGTGC
GCGGCATGGGCTATGTGCTGGATGTGCCCGAGGCACCATGA

Protein sequence :
MRILVVEDEHKTGEYLRKGLTEAGFVTDLIQDGLDGQHMALAEHYDLIILDVMLPRASGWQIIAALRKAGKHTPVLFLTA
RDLVEDRVKGLELGADDYLVKPFAFSELLARIRTLLRRGRTREADVLQVANLEVDVLRRRVQRDGKKIELTAKEFGLLEL
LVRRRGEVLSRSLIASQVWDMNFDSDTNVIEVAMRRLRAKIDDPFEPKLIHTVRGMGYVLDVPEAP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-48 58
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-47 57

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Msip34_0398 YP_003050173.1 two component heavy metal response transcriptional regulator, winged helix family BAC0638 Protein 1e-55 70
Msip34_0398 YP_003050173.1 two component heavy metal response transcriptional regulator, winged helix family BAC0083 Protein 2e-55 69
Msip34_0398 YP_003050173.1 two component heavy metal response transcriptional regulator, winged helix family BAC0197 Protein 7e-58 68
Msip34_0398 YP_003050173.1 two component heavy metal response transcriptional regulator, winged helix family BAC0308 Protein 2e-55 67
Msip34_0398 YP_003050173.1 two component heavy metal response transcriptional regulator, winged helix family BAC0111 Protein 5e-57 66
Msip34_0398 YP_003050173.1 two component heavy metal response transcriptional regulator, winged helix family BAC0125 Protein 3e-55 66
Msip34_0398 YP_003050173.1 two component heavy metal response transcriptional regulator, winged helix family BAC0347 Protein 2e-49 62
Msip34_0398 YP_003050173.1 two component heavy metal response transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 1e-25 45
Msip34_0398 YP_003050173.1 two component heavy metal response transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 1e-22 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Msip34_0398 YP_003050173.1 two component heavy metal response transcriptional regulator, winged helix family VFG0596 Protein 1e-48 58
Msip34_0398 YP_003050173.1 two component heavy metal response transcriptional regulator, winged helix family VFG1390 Protein 1e-32 46
Msip34_0398 YP_003050173.1 two component heavy metal response transcriptional regulator, winged helix family VFG1389 Protein 1e-24 41