Gene Information

Name : emrE (ECB_00493)
Accession : YP_003043718.1
Strain : Escherichia coli REL606
Genome accession: NC_012967
Putative virulence/resistance : Resistance
Product : multidrug efflux protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2076
EC number : -
Position : 540205 - 540537 bp
Length : 333 bp
Strand : +
Note : member of the small MDR (multidrug resistance) family of transporters; in Escherichia coli this protein provides resistance against a number of positively charged compounds including ethidium bromide and erythromycin; proton-dependent secondary transporte

DNA sequence : 
ATGAACCCTTATATTTATCTTGGTGGTGCAATACTTGCAGAGGTCATTGGTACAACCTTAATGAAGTTTTCAGAAGGTTT
TACACGGTTATGGCCATCTGTTGGTACAATTATTTGTTATTGTGCATCATTCTGGTTATTAGCTCAGACGCTGGCTTATA
TTCCTACAGGGATTGCTTATGGTATCTGGTCAGGAGTCGGTATTGTCCTGATTAGCTTACTGTTATGGGGATTTTTCGGC
CAACGGCTGGACCTGCCAGCCATTATAGGCATGATGTTGATTTGTGCCGGTGTGTTGGTTATTAATTTATTGTCACGAAG
CACACCACATTAA

Protein sequence : 
MNPYIYLGGAILAEVIGTTLMKFSEGFTRLWPSVGTIICYCASFWLLAQTLAYIPTGIAYGIWSGVGIVLISLLLWGFFG
QRLDLPAIIGMMLICAGVLVINLLSRSTPH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 1e-12 43
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 1e-12 43
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 1e-12 43
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 1e-12 43
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 1e-12 43
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 1e-12 43
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 1e-12 43
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 1e-12 43
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 2e-12 43
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 1e-12 43
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 1e-12 43
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-12 43
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 2e-12 43
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 1e-12 43
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 1e-12 43
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-12 43
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 2e-12 43
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 1e-12 43
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 1e-12 43
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-12 43
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 2e-12 43
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 1e-12 43
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-12 43
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 2e-12 43
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 1e-12 43
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 1e-12 43
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 1e-12 43
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 1e-12 43
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 1e-12 43
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 1e-12 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
emrE YP_003043718.1 multidrug efflux protein BAC0150 Protein 2e-45 98
emrE YP_003043718.1 multidrug efflux protein NC_002695.1.913273.p Protein 2e-45 98
emrE YP_003043718.1 multidrug efflux protein CP004022.1.gene1549. Protein 1e-23 59
emrE YP_003043718.1 multidrug efflux protein CP001138.1.gene1489. Protein 2e-23 58
emrE YP_003043718.1 multidrug efflux protein BAC0377 Protein 8e-22 55
emrE YP_003043718.1 multidrug efflux protein NC_010410.6003348.p0 Protein 1e-18 51
emrE YP_003043718.1 multidrug efflux protein BAC0002 Protein 1e-18 51
emrE YP_003043718.1 multidrug efflux protein BAC0324 Protein 1e-18 50
emrE YP_003043718.1 multidrug efflux protein AE000516.2.gene3301. Protein 6e-11 48
emrE YP_003043718.1 multidrug efflux protein BAC0249 Protein 6e-11 48
emrE YP_003043718.1 multidrug efflux protein BAC0322 Protein 2e-17 47
emrE YP_003043718.1 multidrug efflux protein BAC0323 Protein 5e-13 43
emrE YP_003043718.1 multidrug efflux protein BAC0140 Protein 1e-13 41
emrE YP_003043718.1 multidrug efflux protein BAC0192 Protein 1e-12 41
emrE YP_003043718.1 multidrug efflux protein BAC0327 Protein 2e-14 41