Gene Information

Name : intB (ECB_04136)
Accession : YP_003047305.1
Strain : Escherichia coli REL606
Genome accession: NC_012967
Putative virulence/resistance : Unknown
Product : putative integrase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG0582
EC number : -
Position : 4479978 - 4481168 bp
Length : 1191 bp
Strand : +
Note : similar to b4271

DNA sequence :
ATGCATCTGCTTGTCCATCCAAATGGTTCTAAGTACTGGCGTTTGCAGTACCGTTATGAGGGAAAGCAAAAAATGCTGGC
ACTTGGGGTTTATCCTGAAATCACACTAGCGGATGCCAGAGTACGTCGTGACGAGACGCGTAAGCTGCTTGCGAATGGCG
TCGATCCGGGAGACAAAAAGAAAAATGATAAGGTTGAACAGAGTAAAGCACGAACCTTTAAAGAAGTCGCGATTGAGTGG
CATGGCACCAATAAAAAGTGGTCTGAAGATCACGCCCATCGTGTGCTAAAAAGTCTTGAAGATAATCTTTTTGCAGCGCT
TGGTGAACGTAATATCGCTGAGTTAAAAACTCGAGATTTATTAGCACCTATTAAGGCCGTAGAAATGTCTGGACGTCTTG
AAGTGGCCGCTCGTCTTCAGCAGCGCACTACAGCCATCATGCGCTATGCAGTGCAAAGTGGGTTAATTGATTATAACCCG
GCACAAGAGATGGCTGGGGCGGTTGCTTCCTGTAATCGACAACATCGTCCCGCGCTTGAATTAAAGCGCATCCCTGAGTT
GCTTACAAAAATAGATAGCTATACTGGTAGGCCGCTAACCCGATGGGCGATAGAACTCACTTTGCTGATCTTTATTCGGT
CCAGTGAGCTGCGTTTTGCTCGTTGGTCAGAGATCGATTTCGAAGCGTCTATATGGACTATCCCACCGGAGCGGGAGCCT
ATTCCTGGAGTGAAACATTCCCATAGAGGCTCAAAAATGCGTACAACGCATCTAGTGCCTCTTTCAACGCAAGCTCTTGC
AATTTTAAAGCAGATAAAACAGTTTTATGGGGCCCATGACTTGATATTTATTGGTGATCACGATTCGCACAAACCCATGA
GTGAGAATACGGTAAATAGTGCGTTACGGGTCATGGGGTATGATACAAAAGTAGAGGTTTGTGGTCATGGCTTTCGAACA
ATGGCCTGTAGTTCATTGGTCGAATCAGGTCTGTGGTCTCGTGATGCTGTTGAACGTCAGATGAGCCACATGGCGCGAAA
TTCAGTGAGGGCCGCGTATATCCATAAAGCAGAGCATCTGGAAGAACGGCGATTGATGCTACAGTGGTGGGCCGATTTTC
TGGATGTAAACAGAGAAAGGTTTATCAGTCCATTTGAATATGCAAAGATTAATAATCCATTAAAACAGTAA

Protein sequence :
MHLLVHPNGSKYWRLQYRYEGKQKMLALGVYPEITLADARVRRDETRKLLANGVDPGDKKKNDKVEQSKARTFKEVAIEW
HGTNKKWSEDHAHRVLKSLEDNLFAALGERNIAELKTRDLLAPIKAVEMSGRLEVAARLQQRTTAIMRYAVQSGLIDYNP
AQEMAGAVASCNRQHRPALELKRIPELLTKIDSYTGRPLTRWAIELTLLIFIRSSELRFARWSEIDFEASIWTIPPEREP
IPGVKHSHRGSKMRTTHLVPLSTQALAILKQIKQFYGAHDLIFIGDHDSHKPMSENTVNSALRVMGYDTKVEVCGHGFRT
MACSSLVESGLWSRDAVERQMSHMARNSVRAAYIHKAEHLEERRLMLQWWADFLDVNRERFISPFEYAKINNPLKQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
intB CAD42017.1 bacteriophage P4 integrase Not tested PAI II 536 Protein 0.0 98
int AAK00456.1 Int Not tested SHI-1 Protein 3e-136 67
int CAC81896.1 integrase Not tested LEE II Protein 1e-137 67
ECO111_3718 YP_003236059.1 putative integrase Not tested LEE Protein 2e-136 67
int AAL51003.1 CP4-like integrase Not tested LEE Protein 6e-138 67
int-phe AAL57571.1 CP4-like integrase Not tested LEE Protein 5e-138 67
Z4313 NP_289539.1 pathogenicity island integrase Not tested OI-122 Protein 3e-137 67
int AAL51028.1 CP4-like integrase Not tested LEE Protein 5e-138 67
ECO103_3550 YP_003223418.1 integrase Not tested LEE Protein 6e-138 67
int-phe AAL60261.1 Int-phe Not tested LEE Protein 5e-138 67
ECO26_5300 YP_003232178.1 integrase Not tested LEE Protein 6e-138 67
int AAK16198.1 Int Not tested PAI-I AL862 Protein 2e-138 67
int ADD91747.1 P4 integrase Not tested PAI-I AL862 Protein 2e-138 67
int AAT48697.1 CP4-like integrase Not tested PAI I 4787 Protein 1e-137 67
SF2964 NP_708738.1 P4-type integrase Not tested SHI-1 Protein 3e-136 67
c5216 NP_757064.1 prophage P4 integrase Not tested PAI II CFT073 Protein 2e-136 67
ORF_1 AAZ04412.1 phage integrase Not tested PAI I APEC-O1 Protein 5e-136 67
APECO1_3534 YP_854214.1 P4-like integrase Not tested PAI I APEC-O1 Protein 6e-136 67
S4822 NP_838459.1 P4-type integrase Not tested SHI-1 Protein 3e-136 67
intP4 CAE85151.1 CP4 integrase protein Not tested PAI V 536 Protein 5e-138 67
ECUMN_3322 YP_002414004.1 integrase Not tested Not named Protein 3e-134 66
c3556 NP_755431.1 prophage P4 integrase Not tested PAI I CFT073 Protein 9e-136 66
SESS1296_03598 AFO66301.1 bacteriophage integrase Not tested SESS LEE Protein 4e-121 59
SESS1635_03816 AFO66367.1 bacteriophage integrase Not tested SESS LEE Protein 4e-121 59
STY4821 NP_458899.1 integrase Not tested SPI-10 Protein 4e-112 58
APECO1_1051 YP_853069.1 phage integrase Not tested PAI IV APEC-O1 Protein 7e-84 56
intB AAD37509.1 P4-like integrase Not tested PAI IV 536 Protein 7e-97 55
int CAA08754.1 integrase Not tested HPI Protein 1e-107 55
int CAA21384.1 - Not tested HPI Protein 5e-107 55
int CAB59974.1 integrase Not tested HPI Protein 3e-108 55
int YP_002346908.1 integrase Not tested HPI Protein 5e-107 55
y2393 NP_669700.1 prophage integrase Not tested HPI Protein 5e-107 55
int2 NP_993013.1 integrase Not tested HPI Protein 5e-107 55
int NP_458759.1 bacteriophage integrase Not tested SPI-7 Protein 1e-109 54
int NP_807963.1 bacteriophage integrase Not tested SPI-7 Protein 1e-109 54
unnamed AAD17660.1 unknown Not tested HPI Protein 1e-103 53
unnamed ABR13507.1 phage integrase Not tested PAGI-6 Protein 6e-98 53
int AAC31482.1 CP4-like integrase Not tested LEE Protein 2e-74 41
int ACU09430.1 integrase Not tested LEE Protein 2e-74 41
intL NP_290239.1 integrase for prophage 933L and the LEE pathogenicity island Not tested LEE Protein 3e-74 41
ECs4534 NP_312561.1 integrase Not tested LEE Protein 3e-74 41
int AAD44730.1 Int Not tested SHI-2 Protein 2e-74 41
aec33 AAW51716.1 Int Not tested AGI-3 Protein 4e-75 41
int CAC39282.1 integrase Not tested LPA Protein 4e-75 41
unnamed AFX83955.1 integrase Not tested SE-PAI Protein 2e-70 41
S4835 NP_839238.1 integrase Not tested SHI-2 Protein 3e-74 41
SF3698 NP_709437.1 integrase Not tested SHI-2 Protein 3e-74 41
int AAD54663.1 Sai integrase Not tested SHI-2 Protein 3e-74 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
intB YP_003047305.1 putative integrase VFG1536 Protein 0.0 98
intB YP_003047305.1 putative integrase VFG0626 Protein 1e-136 67
intB YP_003047305.1 putative integrase VFG1693 Protein 4e-136 66
intB YP_003047305.1 putative integrase VFG0783 Protein 1e-74 41
intB YP_003047305.1 putative integrase VFG0598 Protein 1e-74 41