Gene Information

Name : yeeW (ECB_02809)
Accession : YP_003045996.1
Strain : Escherichia coli REL606
Genome accession: NC_012967
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3009666 - 3010154 bp
Length : 489 bp
Strand : +
Note : similar to b2006

DNA sequence :
ATGAAACTTTCCCTGATGCTGGAAGCCGACAGAATTAATGTGCAGGCACTGAACATGGGGCGAATTGTCGTTGACGTCGA
TGGTGTTAATCTCACTGAACTGATTAACAAGGTCGCTGAAAACGGTTATTCACTCCGCGTGGTGGAGGAATCCGACCAAC
AGTCAACCTGCACACTACCACCGTTTGCAACCCTTGCCGGCATACGCTGCAGTACCGCACATATCACGGAAAAGGATAAC
GCCTGGCTGTACTCGCTGTCACACCAGACCAGTGACTTCGGTGAATCAGAATGGATTCATTTCACAGGTAGCGGATATCT
GTTACGTACCGATGCGTGGTCATATCCGGTTCTGCGGCTTAAACGCCTAGGGCTGTCAAAAACGTTCCGTCGTCTGGTTA
TCACACTTACCCGACGTTATGGCGTCAGTCTCATTCATCTGGATGCCAGCGCTGAATGCCTGCCGGGTTTACCCACTTTC
AACTGGTAA

Protein sequence :
MKLSLMLEADRINVQALNMGRIVVDVDGVNLTELINKVAENGYSLRVVEESDQQSTCTLPPFATLAGIRCSTAHITEKDN
AWLYSLSHQTSDFGESEWIHFTGSGYLLRTDAWSYPVLRLKRLGLSKTFRRLVITLTRRYGVSLIHLDASAECLPGLPTF
NW

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
yeeW CAI43849.1 YeeW protein Not tested LEE Protein 7e-72 99
aec77 AAW51760.1 Aec77 Not tested AGI-3 Protein 2e-69 98
yeeW ADD91698.1 YeeW Not tested PAI-I AL862 Protein 1e-67 92
yeeW CAE85205.1 YeeW protein Not tested PAI V 536 Protein 1e-67 92
c5148 NP_756996.1 hypothetical protein Not tested PAI II CFT073 Protein 5e-68 92
Z1223 NP_286758.1 hypothetical protein Not tested TAI Protein 3e-64 88
Z1662 NP_287164.1 hypothetical protein Not tested TAI Protein 3e-64 88
yeeW AAZ04462.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 3e-62 87
APECO1_3485 YP_854326.1 hypothetical protein Not tested PAI I APEC-O1 Protein 4e-62 87
unnamed AAL08479.1 unknown Not tested SRL Protein 2e-63 87
ECs4540 NP_312567.1 hypothetical protein Not tested LEE Protein 2e-63 86
ECO103_3593 YP_003223450.1 hypothetical protein Not tested LEE Protein 4e-65 86
unnamed CAD42102.1 hypothetical protein Not tested PAI II 536 Protein 2e-62 86
unnamed AAC31487.1 L0008 Not tested LEE Protein 2e-63 86
unnamed ACU09434.1 conserved hypothetical protein Not tested LEE Protein 2e-63 86
Z5092 NP_290243.1 hypothetical protein Not tested LEE Protein 2e-63 86
unnamed AAK00483.1 unknown Not tested SHI-1 Protein 8e-57 86
unnamed AAL67388.1 L0008-like protein Not tested PAI II CFT073 Protein 4e-57 86
unnamed AAL57574.1 unknown Not tested LEE Protein 4e-54 85
yeeW NP_838488.1 hypothetical protein Not tested SHI-1 Protein 5e-63 85
yeeW NP_708774.1 hypothetical protein Not tested SHI-1 Protein 5e-63 85
unnamed CAI43904.1 hypothetical protein Not tested LEE Protein 3e-60 84
z5092 CAD33790.1 Z5092 protein Not tested PAI I 536 Protein 4e-59 84
unnamed CAD66208.1 hypothetical protein Not tested PAI III 536 Protein 1e-60 83

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yeeW YP_003045996.1 hypothetical protein VFG1070 Protein 9e-64 87
yeeW YP_003045996.1 hypothetical protein VFG0787 Protein 7e-64 86
yeeW YP_003045996.1 hypothetical protein VFG1621 Protein 7e-63 86
yeeW YP_003045996.1 hypothetical protein VFG0664 Protein 2e-63 85
yeeW YP_003045996.1 hypothetical protein VFG1531 Protein 2e-59 84
yeeW YP_003045996.1 hypothetical protein VFG1683 Protein 6e-61 83