Gene Information

Name : yeeS (ECB_02805)
Accession : YP_003045992.1
Strain : Escherichia coli REL606
Genome accession: NC_012967
Putative virulence/resistance : Virulence
Product : putative DNA repair protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2003
EC number : -
Position : 3007395 - 3007841 bp
Length : 447 bp
Strand : +
Note : similar to b2002

DNA sequence :
ATGACGCCCGGCGAGCGCAGTCTCATTCTGCGGGCCCTGAAAACCCTGGACCGCCATCTTCATGAACCCGGCGTGGCCTT
CACCTCCACCCGTGCGGCACGGGAATGGCTGATTCTGAACATGGCGGGACTGGAGCGTGAAGAATTCCGGGTGCTGTATC
TGAATAACCAGAATCAACTGATTGCCGGTGAAACCCTCTTCACCGGCACCATCAACCGCACGGAAGTCCATCCCCGGGAA
GTGATTAAACGCGCCCTGTACCACAATGCCGCTGCCGTGGTGCTGGCGCACAATCACCCGTCCGGTGAAGTCACACCCAG
CAAGGCAGACCGCCTTATCACGGAACGTCTGGTACAGGCACTGGGCCTGGTGGATATCCGGGTGCCGGACCATCTGATAG
TCGGTGGCAACCAGGTTTTCTCCTTTGCCGAACATGGTCTGCTTTAA

Protein sequence :
MTPGERSLILRALKTLDRHLHEPGVAFTSTRAAREWLILNMAGLEREEFRVLYLNNQNQLIAGETLFTGTINRTEVHPRE
VIKRALYHNAAAVVLAHNHPSGEVTPSKADRLITERLVQALGLVDIRVPDHLIVGGNQVFSFAEHGLL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
z1217 CAD33787.1 Z1217 protein Not tested PAI I 536 Protein 6e-58 100
yeeS CAI43846.1 YeeS protein Not tested LEE Protein 5e-58 100
yeeS ADD91702.1 YeeS Not tested PAI-I AL862 Protein 4e-58 100
unnamed CAD42098.1 hypothetical protein Not tested PAI II 536 Protein 6e-57 99
Z1217 NP_286752.1 RadC family DNA repair protein Not tested TAI Protein 3e-57 99
yeeS CAE85201.1 YeeS protein Not tested PAI V 536 Protein 1e-57 99
unnamed AAL08475.1 unknown Not tested SRL Protein 1e-57 99
yeeS CAI43901.1 YeeS protein Not tested LEE Protein 1e-57 99
Z1657 NP_287160.1 RadC family DNA repair protein Not tested TAI Protein 6e-56 98
ECO103_3589 YP_003223446.1 radC-like protein YeeS Not tested LEE Protein 4e-56 98
yeeS YP_854323.1 radC-like protein YeeS Not tested PAI I APEC-O1 Protein 2e-56 98
yeeS AAZ04458.1 putative RadC-like protein Not tested PAI I APEC-O1 Protein 1e-56 98
c5152 NP_757000.1 radC-like protein yeeS Not tested PAI II CFT073 Protein 2e-56 98
unnamed AAL67345.1 intergenic-region protein Not tested PAI II CFT073 Protein 2e-56 98
aec73 AAW51756.1 Aec73 Not tested AGI-3 Protein 1e-57 98
unnamed CAD66203.1 hypothetical protein Not tested PAI III 536 Protein 2e-55 97
unnamed AAK00479.1 unknown Not tested SHI-1 Protein 4e-55 96
yeeS NP_708770.1 RADC family DNA repair protein Not tested SHI-1 Protein 4e-55 96
yeeS NP_838484.1 RADC family DNA repair protein Not tested SHI-1 Protein 4e-55 96
VC1786 NP_231421.1 DNA repair protein RadC Not tested VPI-2 Protein 8e-19 56
VC0395_A1383 YP_001217326.1 DNA repair protein RadC Not tested VPI-2 Protein 8e-19 56
VPI2_0034 ACA01849.1 DNA repair protein RadC Not tested VPI-2 Protein 5e-19 56
VC0510 NP_230161.1 DNA repair protein RadC-like protein Not tested VSP-2 Protein 5e-17 54
radC AAN62140.1 putative DNA repair protein RadC Not tested PAGI-2(C) Protein 8e-19 46
radC AAN62275.1 putative DNA repair protein RadC Not tested PAGI-3(SG) Protein 4e-19 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yeeS YP_003045992.1 putative DNA repair protein VFG1528 Protein 3e-58 100
yeeS YP_003045992.1 putative DNA repair protein VFG1617 Protein 2e-57 99
yeeS YP_003045992.1 putative DNA repair protein VFG1066 Protein 4e-58 99
yeeS YP_003045992.1 putative DNA repair protein VFG1678 Protein 8e-56 97
yeeS YP_003045992.1 putative DNA repair protein VFG0660 Protein 1e-55 96
yeeS YP_003045992.1 putative DNA repair protein VFG1119 Protein 2e-19 56