Name : PAU_01965 (PAU_01965) Accession : YP_003040801.1 Strain : Photorhabdus asymbiotica ATCC 43949 Genome accession: NC_012962 Putative virulence/resistance : Resistance Product : methylviologen resistance protein encoded within prophage cp-933 (integral membrane drug resistance protein emre) Function : - COG functional category : P : Inorganic ion transport and metabolism COG ID : COG2076 EC number : - Position : 2201540 - 2201872 bp Length : 333 bp Strand : + Note : Members of this family which have been characterised, belong to the small multidrug resistance (Smr) protein family and are integral membrane proteins. They confer resistance to a wide range of toxic compounds by removing them for the cells. DNA sequence : ATGAATGGATTTGTATATTTAGCAATGGCAATTGTGGCTGAAGTCGTAGCAACGGCTTCATTAAAAGCCTCCGATGGGTT CAGTAAATTGTTTCCTTCTATACTGGTCATCGTTGGGTATGGTATCGCTTTCTGGGGATTATCTCAGGTAGTCAAAGTTG TTCCATTAGGAATTGCTTATGCGATATGGTCTGGCCTTGGTATTGTGTTGGTTTCCATTGCGGCGATATTTTTATATCAG CAGAAGTTGGATTGGGCGGCTATTTTAGGTATGGTGCTCATCATTGCTGGTGTGATGGTAATAAATTTGCTTTCTAACAG CAGTGCACATTAA Protein sequence : MNGFVYLAMAIVAEVVATASLKASDGFSKLFPSILVIVGYGIAFWGLSQVVKVVPLGIAYAIWSGLGIVLVSIAAIFLYQ QKLDWAAILGMVLIIAGVMVINLLSNSSAH |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
qacEdelta1 | AGK07016.1 | QacEdelta1 | Not tested | SGI1 | Protein | 3e-18 | 54 |
qacE-delta1 | AET25389.1 | QacE-delta1 | Not tested | PAGI-2(C) | Protein | 3e-18 | 54 |
qacEdelta1 | ABZ01839.1 | QacEdelta1 | Not tested | SGI2 | Protein | 3e-18 | 54 |
qacEdelta1 | YP_005797150.1 | quaternary ammonium compound-resistance protein | Not tested | AbaR4e | Protein | 4e-18 | 54 |
qacEdelta1 | AGK07074.1 | QacEdelta1 | Not tested | SGI1 | Protein | 3e-18 | 54 |
qacE-delta1 | AFG30112.1 | QacE-delta1 | Not tested | PAGI-2 | Protein | 3e-18 | 54 |
qacEdelta1 | CAJ77030.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 3e-18 | 54 |
ebr | YP_006098377.1 | putative ethidium bromide resistance protein | Not tested | Tn2411 | Protein | 4e-18 | 54 |
qacEdelta1 | AGK07100.1 | QacEdelta1 | Not tested | SGI1 | Protein | 3e-18 | 54 |
qacEdelta1 | AGF34989.1 | QacEdelta1 | Not tested | SGI1 | Protein | 3e-18 | 54 |
qacEdelta1 | CAJ77049.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 3e-18 | 54 |
qacEdelta1 | ACN81026.1 | QacEdelta1 | Not tested | AbaR5 | Protein | 4e-18 | 54 |
qacEdelta1 | AGK07109.1 | QacEdelta1 | Not tested | SGI1 | Protein | 3e-18 | 54 |
qacEdelta1 | AGF35028.1 | QacEdelta1 | Not tested | SGI1 | Protein | 3e-18 | 54 |
qacEdelta1 | CAJ77052.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 3e-18 | 54 |
qacEdelta1 | AFV53123.1 | QacEdelta1 multidrug exporter | Not tested | AbGRI2-1 | Protein | 3e-18 | 54 |
qacEdelta1 | AGF35063.1 | QacEdelta1 | Not tested | SGI1 | Protein | 3e-18 | 54 |
qacEdelta1 | CAJ77088.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 3e-18 | 54 |
qacEdelta1 | AGK36647.1 | QacEdelta1 | Not tested | AbaR26 | Protein | 3e-18 | 54 |
qacEdelta1 | AGK06933.1 | QacEdelta1 | Not tested | SGI1 | Protein | 3e-18 | 54 |
qacE-deltal | ACF06159.1 | quartenary ammonium compound resistance protein | Not tested | Tn5036-like | Protein | 3e-18 | 54 |
qacEdelta1 | AAK02047.1 | quaternary ammonium compound and disinfectant protein | Not tested | SGI1 | Protein | 3e-18 | 54 |
qacEdelta1 | AGK06970.1 | QacEdelta1 | Not tested | SGI1 | Protein | 3e-18 | 54 |
qacE-delta1 | ACY75523.1 | QacE-delta1 | Not tested | Tn6060 | Protein | 3e-18 | 54 |
qacEdelta1 | AAK02056.1 | quaternary ammonium compound and disinfectant protein | Not tested | SGI1 | Protein | 3e-18 | 54 |
ACICU_00227 | YP_001844886.1 | membrane transporter | Not tested | AbaR20 | Protein | 4e-18 | 54 |
qacEdelta1 | AGK06979.1 | QacEdelta1 | Not tested | SGI1 | Protein | 3e-18 | 54 |
qacE-delta1 | ACY75532.1 | QacE-delta1 | Not tested | Tn6060 | Protein | 3e-18 | 54 |
qacEdelta1 | ABB48428.1 | QacEdelta1 | Not tested | SGI1 | Protein | 3e-18 | 54 |
qacEdelta1 | YP_005797134.1 | quaternary ammonium compound-resistance protein | Not tested | AbaR4e | Protein | 4e-18 | 54 |
unnamed | CAD42067.1 | hypothetical protein | Not tested | PAI II 536 | Protein | 4e-18 | 42 |
unnamed | CAD42068.1 | hypothetical protein | Not tested | PAI II 536 | Protein | 5e-13 | 42 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
PAU_01965 | YP_003040801.1 | methylviologen resistance protein encoded within prophage cp-933 (integral membrane drug resistance protein emre) | CP004022.1.gene1549. | Protein | 1e-35 | 75 |
PAU_01965 | YP_003040801.1 | methylviologen resistance protein encoded within prophage cp-933 (integral membrane drug resistance protein emre) | BAC0377 | Protein | 6e-36 | 73 |
PAU_01965 | YP_003040801.1 | methylviologen resistance protein encoded within prophage cp-933 (integral membrane drug resistance protein emre) | BAC0322 | Protein | 1e-22 | 57 |
PAU_01965 | YP_003040801.1 | methylviologen resistance protein encoded within prophage cp-933 (integral membrane drug resistance protein emre) | BAC0324 | Protein | 1e-20 | 55 |
PAU_01965 | YP_003040801.1 | methylviologen resistance protein encoded within prophage cp-933 (integral membrane drug resistance protein emre) | CP001138.1.gene1489. | Protein | 3e-21 | 55 |
PAU_01965 | YP_003040801.1 | methylviologen resistance protein encoded within prophage cp-933 (integral membrane drug resistance protein emre) | BAC0323 | Protein | 1e-18 | 54 |
PAU_01965 | YP_003040801.1 | methylviologen resistance protein encoded within prophage cp-933 (integral membrane drug resistance protein emre) | NC_010410.6003348.p0 | Protein | 4e-20 | 53 |
PAU_01965 | YP_003040801.1 | methylviologen resistance protein encoded within prophage cp-933 (integral membrane drug resistance protein emre) | BAC0002 | Protein | 4e-20 | 53 |
PAU_01965 | YP_003040801.1 | methylviologen resistance protein encoded within prophage cp-933 (integral membrane drug resistance protein emre) | BAC0150 | Protein | 1e-21 | 52 |
PAU_01965 | YP_003040801.1 | methylviologen resistance protein encoded within prophage cp-933 (integral membrane drug resistance protein emre) | NC_002695.1.913273.p | Protein | 1e-21 | 52 |
PAU_01965 | YP_003040801.1 | methylviologen resistance protein encoded within prophage cp-933 (integral membrane drug resistance protein emre) | BAC0329 | Protein | 2e-16 | 50 |
PAU_01965 | YP_003040801.1 | methylviologen resistance protein encoded within prophage cp-933 (integral membrane drug resistance protein emre) | BAC0326 | Protein | 1e-15 | 45 |
PAU_01965 | YP_003040801.1 | methylviologen resistance protein encoded within prophage cp-933 (integral membrane drug resistance protein emre) | BAC0140 | Protein | 8e-13 | 43 |
PAU_01965 | YP_003040801.1 | methylviologen resistance protein encoded within prophage cp-933 (integral membrane drug resistance protein emre) | BAC0321 | Protein | 6e-19 | 42 |
PAU_01965 | YP_003040801.1 | methylviologen resistance protein encoded within prophage cp-933 (integral membrane drug resistance protein emre) | BAC0477 | Protein | 1e-08 | 42 |
PAU_01965 | YP_003040801.1 | methylviologen resistance protein encoded within prophage cp-933 (integral membrane drug resistance protein emre) | BAC0216 | Protein | 4e-09 | 41 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
PAU_01965 | YP_003040801.1 | methylviologen resistance protein encoded within prophage cp-933 (integral membrane drug resistance protein emre) | VFG1586 | Protein | 1e-18 | 42 |
PAU_01965 | YP_003040801.1 | methylviologen resistance protein encoded within prophage cp-933 (integral membrane drug resistance protein emre) | VFG1587 | Protein | 2e-13 | 42 |