|
Name : PC1_2878 (PC1_2878) Accession : YP_003018441.1 Strain : Pectobacterium carotovorum PC1 Genome accession: NC_012917 Putative virulence/resistance : Virulence Product : phage transcriptional regulator, AlpA Function : - COG functional category : K : Transcription COG ID : COG3311 EC number : - Position : 3258851 - 3259057 bp Length : 207 bp Strand : - Note : PFAM: Prophage CP4-57 regulatory; KEGG: kpe:KPK_4961 transcriptional regulator, AlpA family DNA sequence : ATGACTGTTCAACCTTCCCTACTCGAAGACCAGTTTGTCGATATGGCATTCATCACCAAACTGACAGGGCTCACCGACAA ATGGTTTTATAAGCTGATCAAAGATGGCCTGTTTCCCAAACCCATTAAGCTAGGGCGTAGCTCCCGTTGGCTGCAAAGTG AAGTGGCAACCTGGTTACAGCAGCGTATCGAAGAATCCCGTAAATAG Protein sequence : MTVQPSLLEDQFVDMAFITKLTGLTDKWFYKLIKDGLFPKPIKLGRSSRWLQSEVATWLQQRIEESRK |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| unnamed | CAE85187.1 | hypothetical protein | Not tested | PAI V 536 | Protein | 4e-21 | 78 |
| unnamed | CAI43835.1 | hypothetical protein | Not tested | LEE | Protein | 3e-20 | 75 |
| unnamed | ADD91712.1 | putative transcriptional regulator AlpA | Not tested | PAI-I AL862 | Protein | 3e-20 | 75 |
| SF2987 | NP_708761.1 | hypothetical protein | Not tested | SHI-1 | Protein | 2e-20 | 74 |
| ECO103_3577 | YP_003223438.1 | transcriptional regulator | Not tested | LEE | Protein | 2e-20 | 74 |
| rox | AAR97599.1 | regulator of excision | Not tested | SHI-1 | Protein | 2e-20 | 74 |
| S3190 | NP_838473.1 | hypothetical protein | Not tested | SHI-1 | Protein | 2e-20 | 74 |
| unnamed | CAD33739.1 | hypothetical protein | Not tested | PAI I 536 | Protein | 6e-18 | 72 |
| c5192 | NP_757040.1 | hypothetical protein | Not tested | PAI II CFT073 | Protein | 8e-18 | 72 |
| unnamed | AAL08466.1 | unknown | Not tested | SRL | Protein | 2e-20 | 72 |
| Z1188 | NP_286723.1 | hypothetical protein | Not tested | TAI | Protein | 1e-13 | 66 |
| Z1627 | NP_287131.1 | hypothetical protein | Not tested | TAI | Protein | 1e-13 | 66 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| PC1_2878 | YP_003018441.1 | phage transcriptional regulator, AlpA | VFG0651 | Protein | 7e-21 | 74 |
| PC1_2878 | YP_003018441.1 | phage transcriptional regulator, AlpA | VFG1480 | Protein | 2e-18 | 72 |
| PC1_2878 | YP_003018441.1 | phage transcriptional regulator, AlpA | VFG1057 | Protein | 7e-21 | 72 |
