Gene Information

Name : Pjdr2_6026 (Pjdr2_6026)
Accession : YP_003014716.1
Strain : Paenibacillus sp. JDR-2
Genome accession: NC_012914
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 6901135 - 6901851 bp
Length : 717 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: bar:GBAA5106 DNA-binding response regulator

DNA sequence :
ATGGGGATGCAGCGCACAACGATCTTGATTGCGGAGGATGACCCGGATATTGCGGAGCTGATTGCGCTCCATCTAGGCAA
GGAAGGCTACCAGCTGCTGAAGGCCGCTGACGGGAGAGAAGCCGTCCGTCTCGTTCAGACGAATACAATCGATCTGGTTA
TTCTCGACATTATGATGCCGCATATGGACGGTTACGAAGTGGTTCGCGTTATTCGGGAGCAGCAATACCGGATGCCGATT
ATTTTTTTAAGCGCCAAGACGTCCGATTTCGATAAAATATCCGGCCTCGTCATGGGCGCCGACGATTATATGACCAAACC
GTTTAATCCGATGGAGCTGCTCGCAAGAGTAAATGCCCAGCTTAGACGCTTCAGGCAGCTGAATCAGCCGGTCGCCGCTC
CAACTCATGCGGCTTCCGCCATTGTGGCGGGAGGGCTGACGATTGACCAGGAGCAGCGGAACGTTACCTTGTACAATGAC
CGGATTGATCTGACGCCGAAGGAATTCGATATTCTGTATTTGTTGGCCAGCCATCCGAAGAAGGTATTCAGCGCGGAACA
TATTTTCCAGCAGGTATGGGGCGAGGCCTATTACGAGAGCGGCGGCAACACGGTGATGGTTCATATCCGGACATTACGCA
AGAAGCTTGGCGAGGACAAGCAGCATCAGCAATGGATCAAGACGGTCTGGGGGGTAGGTTATGCCTTTCAAGGCTAA

Protein sequence :
MGMQRTTILIAEDDPDIAELIALHLGKEGYQLLKAADGREAVRLVQTNTIDLVILDIMMPHMDGYEVVRVIREQQYRMPI
IFLSAKTSDFDKISGLVMGADDYMTKPFNPMELLARVNAQLRRFRQLNQPVAAPTHAASAIVAGGLTIDQEQRNVTLYND
RIDLTPKEFDILYLLASHPKKVFSAEHIFQQVWGEAYYESGGNTVMVHIRTLRKKLGEDKQHQQWIKTVWGVGYAFQG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 5e-37 44
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-36 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pjdr2_6026 YP_003014716.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 5e-77 67
Pjdr2_6026 YP_003014716.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 2e-76 66
Pjdr2_6026 YP_003014716.1 winged helix family two component transcriptional regulator DQ212986.1.gene4.p01 Protein 1e-46 45
Pjdr2_6026 YP_003014716.1 winged helix family two component transcriptional regulator AM180355.1.gene1830. Protein 2e-47 45
Pjdr2_6026 YP_003014716.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 3e-33 42
Pjdr2_6026 YP_003014716.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 3e-33 42
Pjdr2_6026 YP_003014716.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 3e-33 42
Pjdr2_6026 YP_003014716.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 3e-33 42
Pjdr2_6026 YP_003014716.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 3e-33 42
Pjdr2_6026 YP_003014716.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 3e-33 42
Pjdr2_6026 YP_003014716.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 3e-33 42
Pjdr2_6026 YP_003014716.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 3e-33 42
Pjdr2_6026 YP_003014716.1 winged helix family two component transcriptional regulator NC_014475.1.orf0.gen Protein 5e-48 42
Pjdr2_6026 YP_003014716.1 winged helix family two component transcriptional regulator AF162694.1.orf4.gene Protein 4e-44 42
Pjdr2_6026 YP_003014716.1 winged helix family two component transcriptional regulator NC_005054.2598277.p0 Protein 5e-48 42
Pjdr2_6026 YP_003014716.1 winged helix family two component transcriptional regulator AF130997.1.orf0.gene Protein 2e-45 42
Pjdr2_6026 YP_003014716.1 winged helix family two component transcriptional regulator EU250284.1.orf4.gene Protein 2e-41 41
Pjdr2_6026 YP_003014716.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 9e-41 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pjdr2_6026 YP_003014716.1 winged helix family two component transcriptional regulator VFG1563 Protein 3e-37 44
Pjdr2_6026 YP_003014716.1 winged helix family two component transcriptional regulator VFG1702 Protein 2e-36 44