Gene Information

Name : Pjdr2_1696 (Pjdr2_1696)
Accession : YP_003010446.1
Strain : Paenibacillus sp. JDR-2
Genome accession: NC_012914
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1998699 - 1999388 bp
Length : 690 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: bar:GBAA4920 DNA-binding response regulator

DNA sequence : 
ATGATCAAGTCGGTTTTGCTGATTGAAGACGATACAACGATAGCGGAGCTTCAGCGGGATTACCTGGAGATTAACGGATT
TGAAGTGCAGGTAGCCGCTGATGGAGAAGCGGGTCTGGCAATGAGCTTGTCCGGCCATTATGATCTGGTCATTCTGGACC
TGATGATACCCAAGATGAACGGGTTCGAGGTTTGCAAGAAAATAAGGGAGAAGCAGGACATTCCGATTCTTATCGTCACT
TCTCTCCATGACGATATTGACGTGATTCGGGGGTTGGGTCTTGGCGCGGACGATTACATTACCAAACCGTTTAAGCCAGC
CGAGTTGGTTGCAAGAGTGAAGGCCCATCTGGCCAGGTATGAGCGGCTGGTTGGCAAAAAAGACGTCAAAAACATCGTTC
AAATTCGTGATCTGTATATCGATCCGGATACGCGCAAGGTCTATGTGAATGACGAGGAAGCGGTATTAACAACGAAAGAA
TTTGATCTGCTGTACTTCCTGGCGAGTCATCCCAATAAAGTGTTTAGCAAAGAGCATCTCTTTGAACGGATATGGGGAGT
TGACGCGCTTGGAGATATGCAGACGGTTACCGTGCATATTAGGAAAATTCGCGAAAAAATTGAAAAGGACTCTGCTAACC
CCGTCTATATCGAAACGGTATGGGGGGCTGGCTATCGCTGCAGAGGGTAA

Protein sequence : 
MIKSVLLIEDDTTIAELQRDYLEINGFEVQVAADGEAGLAMSLSGHYDLVILDLMIPKMNGFEVCKKIREKQDIPILIVT
SLHDDIDVIRGLGLGADDYITKPFKPAELVARVKAHLARYERLVGKKDVKNIVQIRDLYIDPDTRKVYVNDEEAVLTTKE
FDLLYFLASHPNKVFSKEHLFERIWGVDALGDMQTVTVHIRKIREKIEKDSANPVYIETVWGAGYRCRG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 9e-37 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pjdr2_1696 YP_003010446.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 1e-43 46
Pjdr2_1696 YP_003010446.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 1e-44 44
Pjdr2_1696 YP_003010446.1 winged helix family two component transcriptional regulator AM180355.1.gene1830. Protein 1e-41 44
Pjdr2_1696 YP_003010446.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 4e-45 43
Pjdr2_1696 YP_003010446.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 5e-36 43
Pjdr2_1696 YP_003010446.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 4e-38 42
Pjdr2_1696 YP_003010446.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 1e-39 42
Pjdr2_1696 YP_003010446.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 4e-40 42
Pjdr2_1696 YP_003010446.1 winged helix family two component transcriptional regulator NC_014475.1.orf0.gen Protein 2e-40 41
Pjdr2_1696 YP_003010446.1 winged helix family two component transcriptional regulator NC_005054.2598277.p0 Protein 2e-40 41
Pjdr2_1696 YP_003010446.1 winged helix family two component transcriptional regulator DQ212986.1.gene4.p01 Protein 5e-37 41
Pjdr2_1696 YP_003010446.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 1e-39 41
Pjdr2_1696 YP_003010446.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 5e-40 41
Pjdr2_1696 YP_003010446.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 4e-40 41
Pjdr2_1696 YP_003010446.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 4e-40 41
Pjdr2_1696 YP_003010446.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 5e-40 41
Pjdr2_1696 YP_003010446.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 4e-40 41
Pjdr2_1696 YP_003010446.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 4e-40 41
Pjdr2_1696 YP_003010446.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 4e-40 41
Pjdr2_1696 YP_003010446.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 4e-40 41
Pjdr2_1696 YP_003010446.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 4e-40 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pjdr2_1696 YP_003010446.1 winged helix family two component transcriptional regulator VFG1702 Protein 3e-37 41