Gene Information

Name : NT05HA_0168 (NT05HA_0168)
Accession : YP_003006693.1
Strain : Aggregatibacter aphrophilus NJ8700
Genome accession: NC_012913
Putative virulence/resistance : Resistance
Product : heavy metal-binding protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2608
EC number : -
Position : 161341 - 161553 bp
Length : 213 bp
Strand : +
Note : identified by Glimmer3; putative

DNA sequence : 
ATGCAAAACGTAACCCTAAAAATTGATGGCATGACCTGTGGTGGTTGTGTGAAAAGCGTGACTCGCGTATTGAGTGAATT
AGATGGCGTGGTGCACGCAGACGTAAGTTTGGAAAAAGCGCAAGCGGTCGTTAGTTTTGATGAAAATAAAGTGCAACCGG
CAGTGTTAGTGGACGCCGTGGAAGATGCCGGGTTTGATGCCGAAGTGGCATGA

Protein sequence : 
MQNVTLKIDGMTCGGCVKSVTRVLSELDGVVHADVSLEKAQAVVSFDENKVQPAVLVDAVEDAGFDAEVA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 1e-11 46
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 2e-11 46
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 1e-10 45
merP ABQ57373.1 MerP Not tested SGI1 Protein 8e-11 45
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 8e-11 45
merP AFG30122.1 MerP Not tested PAGI-2 Protein 8e-11 45
merP AGK07023.1 MerP Not tested SGI1 Protein 8e-11 45
merP AGK07081.1 MerP Not tested SGI1 Protein 8e-11 45
merP AAN62179.1 periplasmic mercuric ion binding protein MerP Not tested PAGI-2(C) Protein 6e-11 45
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 4e-12 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
NT05HA_0168 YP_003006693.1 heavy metal-binding protein BAC0678 Protein 1e-10 43
NT05HA_0168 YP_003006693.1 heavy metal-binding protein BAC0231 Protein 1e-10 42
NT05HA_0168 YP_003006693.1 heavy metal-binding protein BAC0679 Protein 2e-10 41