Name : NT05HA_0168 (NT05HA_0168) Accession : YP_003006693.1 Strain : Aggregatibacter aphrophilus NJ8700 Genome accession: NC_012913 Putative virulence/resistance : Resistance Product : heavy metal-binding protein Function : - COG functional category : P : Inorganic ion transport and metabolism COG ID : COG2608 EC number : - Position : 161341 - 161553 bp Length : 213 bp Strand : + Note : identified by Glimmer3; putative DNA sequence : ATGCAAAACGTAACCCTAAAAATTGATGGCATGACCTGTGGTGGTTGTGTGAAAAGCGTGACTCGCGTATTGAGTGAATT AGATGGCGTGGTGCACGCAGACGTAAGTTTGGAAAAAGCGCAAGCGGTCGTTAGTTTTGATGAAAATAAAGTGCAACCGG CAGTGTTAGTGGACGCCGTGGAAGATGCCGGGTTTGATGCCGAAGTGGCATGA Protein sequence : MQNVTLKIDGMTCGGCVKSVTRVLSELDGVVHADVSLEKAQAVVSFDENKVQPAVLVDAVEDAGFDAEVA |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
merP | ACN81007.1 | MerP periplasmic mercuric ion binding protein | Not tested | AbaR5 | Protein | 2e-11 | 46 |
merP | CAJ77062.1 | Periplasmic mercuric ion binding protein | Not tested | AbaR1 | Protein | 1e-11 | 46 |
merP | ABQ57373.1 | MerP | Not tested | SGI1 | Protein | 8e-11 | 45 |
merP | AET25399.1 | MerP | Not tested | PAGI-2(C) | Protein | 8e-11 | 45 |
merP | AFG30122.1 | MerP | Not tested | PAGI-2 | Protein | 8e-11 | 45 |
merP | AGK07023.1 | MerP | Not tested | SGI1 | Protein | 8e-11 | 45 |
merP | AGK07081.1 | MerP | Not tested | SGI1 | Protein | 8e-11 | 45 |
merP | YP_006098389.1 | mercuric ion transport protein | Not tested | Tn2411 | Protein | 1e-10 | 45 |
merP | AAN62179.1 | periplasmic mercuric ion binding protein MerP | Not tested | PAGI-2(C) | Protein | 6e-11 | 45 |
unnamed | ABR13399.1 | copper-transporting ATPase 2 | Not tested | PAGI-5 | Protein | 4e-12 | 43 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
NT05HA_0168 | YP_003006693.1 | heavy metal-binding protein | BAC0678 | Protein | 1e-10 | 43 |
NT05HA_0168 | YP_003006693.1 | heavy metal-binding protein | BAC0231 | Protein | 1e-10 | 42 |
NT05HA_0168 | YP_003006693.1 | heavy metal-binding protein | BAC0679 | Protein | 2e-10 | 41 |