
|
Name : Dd1591_3709 (Dd1591_3709) Accession : YP_003005992.1 Strain : Dickeya zeae Ech1591 Genome accession: NC_012912 Putative virulence/resistance : Virulence Product : phage transcriptional regulator AlpA Function : - COG functional category : K : Transcription COG ID : COG3311 EC number : - Position : 4198196 - 4198399 bp Length : 204 bp Strand : - Note : PFAM: Prophage CP4-57 regulatory; KEGG: ypn:YPN_2905 transcriptional regulator DNA sequence : ATGATGTCCAATCTCACTCTGTTGCGTTTGCCCGATGTGATGAAAAAAACCAGCCTCAAAAAATCCTGGATCTATTACCT GATCGATCGTGGCGAGTTTCCCCAGCCGGTGAAGCTGGGCGCACGTTCTGTCGCCTGGGTGGAGAGTGAAATCAACGACT GGATTGCCGAGCGTATCCGTCAGCGGGCGGAGGGGCGCAAATGA Protein sequence : MMSNLTLLRLPDVMKKTSLKKSWIYYLIDRGEFPQPVKLGARSVAWVESEINDWIAERIRQRAEGRK |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| VPI2_0033 | AAX20900.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 2e-10 | 49 |
| VC1785 | NP_231420.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 4e-10 | 49 |
| VC0395_A1382 | YP_001217325.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 4e-10 | 49 |
| unnamed | CAB46594.1 | DNA-binding protein | Not tested | HPI | Protein | 2e-10 | 48 |
| unnamed | CAA21398.1 | - | Not tested | HPI | Protein | 3e-10 | 48 |
| VC0497 | NP_230151.1 | transcriptional regulator | Not tested | VSP-2 | Protein | 6e-10 | 48 |
| PMI2608 | YP_002152324.1 | prophage regulatory protein | Not tested | Not named | Protein | 4e-08 | 47 |
| VC1809 | NP_231443.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 3e-11 | 45 |
| VC0395_A1406 | YP_001217349.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 3e-11 | 45 |
| VPI2_0041 | ACA01856.1 | predicted transcriptional regulator | Not tested | VPI-2 | Protein | 2e-11 | 45 |
| ORF C109 | AAN62202.1 | phage-related protein | Not tested | PAGI-2(C) | Protein | 1e-10 | 44 |
| ORF SG104 | AAN62325.1 | phage-related protein | Not tested | PAGI-3(SG) | Protein | 1e-09 | 43 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| Dd1591_3709 | YP_003005992.1 | phage transcriptional regulator AlpA | VFG1118 | Protein | 1e-10 | 49 |
| Dd1591_3709 | YP_003005992.1 | phage transcriptional regulator AlpA | VFG1141 | Protein | 8e-12 | 45 |