Gene Information

Name : Dd1591_3689 (Dd1591_3689)
Accession : YP_003005975.1
Strain : Dickeya zeae Ech1591
Genome accession: NC_012912
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4180084 - 4180398 bp
Length : 315 bp
Strand : -
Note : PFAM: protein of unknown function DUF1219; KEGG: eca:ECA2853 hypothetical protein

DNA sequence :
ATGACTCACCACCCCGCATCGCCTCACGATACGCCACCGTTAACGCCGGTCCACATCTGGCAGCGCCTGCTGACGTACCT
GCTGGACAAGCACTACGGGCTGACGCTCAACGACACGCCATTTTGTGAAGAAGCCGAGATCCAGGCCCACCTCGACGCCG
GAGTTTCGCTGCCGGACGCCGTGAACTTTCTGGTGGAGCGCTATGAGCTGGTGCGTATCGATCGCAGCGGTTTTAGCTGG
CAGGAGCAACAACCGTTTCTGAACGCGGTCGATATTCTCCGCGCCAGACGCGCCACCGGCCTGCTCAAACCATAA

Protein sequence :
MTHHPASPHDTPPLTPVHIWQRLLTYLLDKHYGLTLNDTPFCEEAEIQAHLDAGVSLPDAVNFLVERYELVRIDRSGFSW
QEQQPFLNAVDILRARRATGLLKP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed AAL57575.1 unknown Not tested LEE Protein 1e-23 66
ECO103_3592 YP_003223449.1 hypothetical protein Not tested LEE Protein 2e-23 65
yeeV YP_854325.1 hypothetical protein Not tested PAI I APEC-O1 Protein 1e-23 65
unnamed AAL67342.1 intergenic-region protein Not tested PAI II CFT073 Protein 2e-23 65
yeeV CAE85204.1 YeeV protein Not tested PAI V 536 Protein 2e-23 65
unnamed CAD42101.1 hypothetical protein Not tested PAI II 536 Protein 2e-23 65
unnamed AAL08478.1 unknown Not tested SRL Protein 1e-22 63
unnamed AAK00482.1 unknown Not tested SHI-1 Protein 1e-23 63
yeeV NP_838487.1 hypothetical protein Not tested SHI-1 Protein 2e-23 63
yeeV NP_708773.1 hypothetical protein Not tested SHI-1 Protein 2e-23 63
unnamed CAD66207.1 hypothetical protein Not tested PAI III 536 Protein 7e-24 62
unnamed AAC31486.1 L0007 Not tested LEE Protein 1e-22 62
Z5091 NP_290242.1 hypothetical protein Not tested LEE Protein 2e-22 62
unnamed ACU09433.1 conserved hypothetical protein Not tested LEE Protein 1e-22 62
ECs4539 NP_312566.1 hypothetical protein Not tested LEE Protein 2e-22 62
unnamed CAI43848.1 hypothetical protein Not tested LEE Protein 9e-23 62
aec76 AAW51759.1 Aec76 Not tested AGI-3 Protein 9e-23 62
z5091 CAD33789.1 Z5091 protein Not tested PAI I 536 Protein 6e-23 62
yeeV ADD91699.1 YeeV Not tested PAI-I AL862 Protein 3e-22 61
unnamed AAL67389.1 L0007-like protein Not tested PAI II CFT073 Protein 3e-22 61
c5149 NP_756997.1 hypothetical protein Not tested PAI II CFT073 Protein 4e-22 61
YE3459 YP_001007621.1 hypothetical protein Not tested YAPI Protein 4e-10 44

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dd1591_3689 YP_003005975.1 hypothetical protein VFG1620 Protein 9e-24 65
Dd1591_3689 YP_003005975.1 hypothetical protein VFG1069 Protein 4e-23 63
Dd1591_3689 YP_003005975.1 hypothetical protein VFG0663 Protein 4e-24 63
Dd1591_3689 YP_003005975.1 hypothetical protein VFG1682 Protein 3e-24 62
Dd1591_3689 YP_003005975.1 hypothetical protein VFG0786 Protein 5e-23 62
Dd1591_3689 YP_003005975.1 hypothetical protein VFG1530 Protein 3e-23 62