Gene Information

Name : Dd1591_3563 (Dd1591_3563)
Accession : YP_003005851.1
Strain : Dickeya zeae Ech1591
Genome accession: NC_012912
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 4042054 - 4042485 bp
Length : 432 bp
Strand : -
Note : KEGG: bmn:BMA10247_3037 MerR family transcriptional regulator; TIGRFAM: Cd(II)/Pb(II)-responsive transcriptional regulator; PFAM: Transcription regulator MerR DNA binding; regulatory protein MerR; SMART: regulatory protein MerR

DNA sequence : 
ATGAAAATCGGCGATCTGGCGAAAGCGACCAACACCACACCGGAAACCATTCGTTTTTATGAGAAGAAAGGGCTATTGCC
CGAACCGGAACGCACCGAAGGAAATTACCGTCATTACCATCAGTTTCATGTCGACCGGCTACGGTTTATCCGTAACTGCC
GTTCGTTGGATATGAACCATGATGAAATCCGCGCGTTGATTGCGCTTAGCGAGCAACCGGCCGCCAGTTGTGAAGGGGTG
AATGCGTTGCTGAACGAACATCTGGGGCATGTGGAAGCGCGTATCGCCGAGCTACAACAGCTGAAAGCGCAGTTGATGCA
CATCAGCCAGCGTTGTCAGGTGACGCAGACGGTGGACGGTTGCGGCATCCTGCACGGTTTGTCGGCGCTGGAGCTTGAAG
AGCGCGGCGCCGGCCATACGCATTTGGGGTGA

Protein sequence : 
MKIGDLAKATNTTPETIRFYEKKGLLPEPERTEGNYRHYHQFHVDRLRFIRNCRSLDMNHDEIRALIALSEQPAASCEGV
NALLNEHLGHVEARIAELQQLKAQLMHISQRCQVTQTVDGCGILHGLSALELEERGAGHTHLG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
cadR ACS32041.1 MerR family transcriptional regulator Not tested AbaR5 Protein 7e-30 47
ACICU_00234 YP_001844893.1 transcriptional regulator Not tested AbaR20 Protein 3e-30 47
cadR ADZ05769.1 MerR family transcriptional regulator Not tested AbaR11 Protein 5e-30 47
cadR ACN81029.1 MerR family transcriptional regulator Not tested AbaR5 Protein 3e-30 47
pbrR CAJ77021.1 transcription regulator Not tested AbaR1 Protein 5e-30 47
pbrR CAJ77094.1 Transcriptional regulator Not tested AbaR1 Protein 2e-30 47
cadR AGK36653.1 MerR family transcriptional regulator Not tested AbaR26 Protein 2e-30 47
ORF C98 AAN62191.1 putative transcriptional regulator Not tested PAGI-2(C) Protein 8e-31 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dd1591_3563 YP_003005851.1 MerR family transcriptional regulator BAC0301 Protein 2e-31 54
Dd1591_3563 YP_003005851.1 MerR family transcriptional regulator BAC0058 Protein 2e-34 51