Gene Information

Name : Dd1591_2946 (Dd1591_2946)
Accession : YP_003005247.1
Strain : Dickeya zeae Ech1591
Genome accession: NC_012912
Putative virulence/resistance : Resistance
Product : small multidrug resistance protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2076
EC number : -
Position : 3357601 - 3357930 bp
Length : 330 bp
Strand : -
Note : PFAM: small multidrug resistance protein; KEGG: esa:ESA_01940 hypothetical protein

DNA sequence :
ATGACTTATTTATTTCTTTGTCTGGCGATTGTGTCGGAAGTGGTGGCGACTACGGCGCTGAAATTATCGGAGAGCTTTAC
CCGGCCATTGCCGAGCGTGGTGACGGTGGTTTTTTATATCATCGCATTTTACTGCCTGACCCTTTCCATGCGGGTGCTGC
CGACCGGCGTGATTTACGCTATCTGGTCGGGTGCGGGAATTGTGTTGATCGCAGCGATAAGCTGGATTTTTTACGGTCAG
CGGTTGGACTGGCCGACCGTGCTGGGAATGGCGTTAATCATCGCCGGGGTTGCTGTCATTAACCTGTTTTCCAATTCTGT
GGCACATTGA

Protein sequence :
MTYLFLCLAIVSEVVATTALKLSESFTRPLPSVVTVVFYIIAFYCLTLSMRVLPTGVIYAIWSGAGIVLIAAISWIFYGQ
RLDWPTVLGMALIIAGVAVINLFSNSVAH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 4e-18 55
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 4e-18 55
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 4e-18 55
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 4e-18 55
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 4e-18 55
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 4e-18 55
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 4e-18 55
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 4e-18 55
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 4e-18 55
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 4e-18 55
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 4e-18 55
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 4e-18 55
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 4e-18 55
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 6e-18 55
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 4e-18 55
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 4e-18 55
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 4e-18 55
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 6e-18 55
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 4e-18 55
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 4e-18 55
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 4e-18 55
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 6e-18 55
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 4e-18 55
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 4e-18 55
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 4e-18 55
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 6e-18 55
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 4e-18 55
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 4e-18 55
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 4e-18 55
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 6e-18 55

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dd1591_2946 YP_003005247.1 small multidrug resistance protein CP001138.1.gene1489. Protein 1e-26 65
Dd1591_2946 YP_003005247.1 small multidrug resistance protein BAC0002 Protein 2e-26 57
Dd1591_2946 YP_003005247.1 small multidrug resistance protein NC_010410.6003348.p0 Protein 2e-26 57
Dd1591_2946 YP_003005247.1 small multidrug resistance protein NC_002695.1.913273.p Protein 1e-19 55
Dd1591_2946 YP_003005247.1 small multidrug resistance protein CP004022.1.gene1549. Protein 2e-19 55
Dd1591_2946 YP_003005247.1 small multidrug resistance protein BAC0323 Protein 2e-18 55
Dd1591_2946 YP_003005247.1 small multidrug resistance protein BAC0322 Protein 6e-22 54
Dd1591_2946 YP_003005247.1 small multidrug resistance protein BAC0324 Protein 2e-22 54
Dd1591_2946 YP_003005247.1 small multidrug resistance protein BAC0150 Protein 1e-19 53
Dd1591_2946 YP_003005247.1 small multidrug resistance protein BAC0377 Protein 4e-22 52
Dd1591_2946 YP_003005247.1 small multidrug resistance protein BAC0192 Protein 3e-15 47
Dd1591_2946 YP_003005247.1 small multidrug resistance protein AE000516.2.gene3301. Protein 4e-06 45
Dd1591_2946 YP_003005247.1 small multidrug resistance protein BAC0249 Protein 4e-06 45
Dd1591_2946 YP_003005247.1 small multidrug resistance protein BAC0329 Protein 6e-13 42
Dd1591_2946 YP_003005247.1 small multidrug resistance protein BAC0140 Protein 2e-12 41