Gene Information

Name : phoP (SDEG_0589)
Accession : YP_002996305.1
Strain : Streptococcus dysgalactiae GGS_124
Genome accession: NC_012891
Putative virulence/resistance : Resistance
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 560183 - 560890 bp
Length : 708 bp
Strand : +
Note : similar to response regulator [Streptococcus pneumoniae R6]

DNA sequence : 
ATGACAAAACAAATCTTATTAGTGGATGATGAAGAACACATTTTGAGGCTACTGGATTATCATCTCGGTAAAGAAGGGTT
TTCCACACAATTGGTAACAGATGGCCGAAAAGCATTGACATTGGCAGAAACAGAGCCTTTTGACTTTATCCTACTGGATA
TTATGTTGCCTCAGTTAGACGGCATAGAAGTGTGTAAGCGACTGAGAGCTAAAGGAATAAAAACTCCGATTATGATGGTT
TCTGCTAAAAGTGATGAATTTGATAAGGTTTTGGCCTTGGAATTAGGAGCTGATGACTACCTGACTAAGCCTTTTAGCCC
TAGAGAATTGCTGGCGCGTGTCAAGGCTATTTTACGTCGAACCAGTAAAGAGCAGCAAGAAGATGACACAGATGATTTCA
GGGATGATTATCGGGTATTTGGGGCCCTGACCGTCTATCCAGACCGGCATGAGGTTTATAAGGCAGATCATTTATTGAGC
CTTACCCCAAAGGAATTTGAACTCTTGCTCTATCTTATGAAACATCCCAACATGACATTAACTAGGGAACGTTTACTTGA
ACGGATTTGGGGATATGATTTTGGACAAGAAACCCGTTTAGTGGATGTTCATATTGGCAAATTGAGAGATAAGATAGAGG
ATAATCCTAAAGACCCTCAATTTATTCAAACGATTAGAGGCTATGGGTATAAGTTTAAGGAGTTATAG

Protein sequence : 
MTKQILLVDDEEHILRLLDYHLGKEGFSTQLVTDGRKALTLAETEPFDFILLDIMLPQLDGIEVCKRLRAKGIKTPIMMV
SAKSDEFDKVLALELGADDYLTKPFSPRELLARVKAILRRTSKEQQEDDTDDFRDDYRVFGALTVYPDRHEVYKADHLLS
LTPKEFELLLYLMKHPNMTLTRERLLERIWGYDFGQETRLVDVHIGKLRDKIEDNPKDPQFIQTIRGYGYKFKEL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 7e-31 41
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 1e-30 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoP YP_002996305.1 two-component response regulator NC_012469.1.7686381. Protein 3e-98 89
phoP YP_002996305.1 two-component response regulator NC_002952.2859905.p0 Protein 2e-57 54
phoP YP_002996305.1 two-component response regulator NC_002745.1124361.p0 Protein 2e-57 54
phoP YP_002996305.1 two-component response regulator NC_009782.5559369.p0 Protein 2e-57 54
phoP YP_002996305.1 two-component response regulator NC_002951.3237708.p0 Protein 2e-57 54
phoP YP_002996305.1 two-component response regulator NC_003923.1003749.p0 Protein 2e-57 54
phoP YP_002996305.1 two-component response regulator NC_002758.1121668.p0 Protein 2e-57 54
phoP YP_002996305.1 two-component response regulator NC_009641.5332272.p0 Protein 2e-57 54
phoP YP_002996305.1 two-component response regulator NC_013450.8614421.p0 Protein 2e-57 54
phoP YP_002996305.1 two-component response regulator NC_007793.3914279.p0 Protein 2e-57 54
phoP YP_002996305.1 two-component response regulator NC_007622.3794472.p0 Protein 2e-57 54
phoP YP_002996305.1 two-component response regulator HE999704.1.gene2815. Protein 7e-58 51
phoP YP_002996305.1 two-component response regulator AE016830.1.gene1681. Protein 1e-56 50
phoP YP_002996305.1 two-component response regulator NC_012469.1.7685629. Protein 1e-44 49
phoP YP_002996305.1 two-component response regulator AE000516.2.gene3505. Protein 4e-39 44
phoP YP_002996305.1 two-component response regulator HE999704.1.gene1528. Protein 3e-38 43
phoP YP_002996305.1 two-component response regulator CP001485.1.gene721.p Protein 6e-37 43
phoP YP_002996305.1 two-component response regulator AF155139.2.orf0.gene Protein 6e-40 42
phoP YP_002996305.1 two-component response regulator AF310956.2.orf0.gene Protein 3e-31 41
phoP YP_002996305.1 two-component response regulator AE016830.1.gene2255. Protein 5e-31 41
phoP YP_002996305.1 two-component response regulator U35369.1.gene1.p01 Protein 5e-31 41
phoP YP_002996305.1 two-component response regulator CP004022.1.gene3215. Protein 5e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoP YP_002996305.1 two-component response regulator VFG1389 Protein 3e-29 41