Gene Information

Name : Dd703_3722 (Dd703_3722)
Accession : YP_002989299.1
Strain : Dickeya dadantii Ech703
Genome accession: NC_012880
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4312741 - 4313412 bp
Length : 672 bp
Strand : -
Note : KEGG: spe:Spro_1498 two component heavy metal response transcriptional regulator; TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator; SMART: response regulator receiver

DNA sequence :
ATGCGTATTCTGGTGGTTGAGGACGATGTCAGTACCGGCGATTACCTGAAAAAAGGGCTGACCGAAGCCGGATATGCGGT
CGATCTGGCGCGCAGCGGCACTGAAGGATTGTTCAACGCGCTGGAGCATGGCTACGACGCCATCATTTTGGACGTCATGT
TGCCGGGGTTGAGCGGCTGGCAGCTTATCGAAATGCTGCGTAAGAAAAGCGATGTGCCGGTACTGTTTCTGACCGCGCGC
GACCAGTTGCACGACCGTATTCGCGGGCTGGAACTGGGGGCCGACGACTATCTGATCAAACCTTTTTCGTTTACTGAATT
GGTGTTGCGCATACGTACCTTGCTGCGTCGCGGCGTGGTGCGCGAGGCGGATCACTACGCAGTGGCGGATTTGCGCCTGG
ATGTGCTGCGGCGCAAGGCCACGCGGCAGGAGGTGGTTATCCCTCTGACCAACAAGGAGTTTATGCTGTTGCATCTGCTG
GTGCGACGCGAGGGTGAAGTGCTCTCGCGCACCCTGATCGCCTCGCAGGTGTGGGACATGAATTTCGATAGCGACACCAA
TGTGGTGGATGTGGCGGTGAAACGTCTGCGTGCCAAGATTGATAAACCTTTCGATATCAAGCTGATCCATACCGTGCGCG
GTATCGGTTATGTGTGCGAGCCGCGCGCATGA

Protein sequence :
MRILVVEDDVSTGDYLKKGLTEAGYAVDLARSGTEGLFNALEHGYDAIILDVMLPGLSGWQLIEMLRKKSDVPVLFLTAR
DQLHDRIRGLELGADDYLIKPFSFTELVLRIRTLLRRGVVREADHYAVADLRLDVLRRKATRQEVVIPLTNKEFMLLHLL
VRREGEVLSRTLIASQVWDMNFDSDTNVVDVAVKRLRAKIDKPFDIKLIHTVRGIGYVCEPRA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-54 53
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-53 53

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dd703_3722 YP_002989299.1 two component heavy metal response transcriptional regulator, winged helix family BAC0197 Protein 4e-66 63
Dd703_3722 YP_002989299.1 two component heavy metal response transcriptional regulator, winged helix family BAC0125 Protein 1e-65 62
Dd703_3722 YP_002989299.1 two component heavy metal response transcriptional regulator, winged helix family BAC0308 Protein 5e-61 60
Dd703_3722 YP_002989299.1 two component heavy metal response transcriptional regulator, winged helix family BAC0638 Protein 4e-56 60
Dd703_3722 YP_002989299.1 two component heavy metal response transcriptional regulator, winged helix family BAC0083 Protein 3e-62 59
Dd703_3722 YP_002989299.1 two component heavy metal response transcriptional regulator, winged helix family BAC0111 Protein 8e-62 59
Dd703_3722 YP_002989299.1 two component heavy metal response transcriptional regulator, winged helix family BAC0347 Protein 1e-53 55
Dd703_3722 YP_002989299.1 two component heavy metal response transcriptional regulator, winged helix family U82965.2.orf14.gene. Protein 1e-29 42
Dd703_3722 YP_002989299.1 two component heavy metal response transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 4e-28 42
Dd703_3722 YP_002989299.1 two component heavy metal response transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 1e-35 41
Dd703_3722 YP_002989299.1 two component heavy metal response transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 1e-35 41
Dd703_3722 YP_002989299.1 two component heavy metal response transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 1e-35 41
Dd703_3722 YP_002989299.1 two component heavy metal response transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 1e-35 41
Dd703_3722 YP_002989299.1 two component heavy metal response transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 1e-35 41
Dd703_3722 YP_002989299.1 two component heavy metal response transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 1e-35 41
Dd703_3722 YP_002989299.1 two component heavy metal response transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 1e-35 41
Dd703_3722 YP_002989299.1 two component heavy metal response transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 1e-35 41
Dd703_3722 YP_002989299.1 two component heavy metal response transcriptional regulator, winged helix family Y16952.3.orf35.gene. Protein 4e-23 41
Dd703_3722 YP_002989299.1 two component heavy metal response transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 9e-31 41
Dd703_3722 YP_002989299.1 two component heavy metal response transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 1e-30 41
Dd703_3722 YP_002989299.1 two component heavy metal response transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 1e-30 41
Dd703_3722 YP_002989299.1 two component heavy metal response transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 1e-30 41
Dd703_3722 YP_002989299.1 two component heavy metal response transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 1e-30 41
Dd703_3722 YP_002989299.1 two component heavy metal response transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 8e-31 41
Dd703_3722 YP_002989299.1 two component heavy metal response transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 1e-30 41
Dd703_3722 YP_002989299.1 two component heavy metal response transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 1e-30 41
Dd703_3722 YP_002989299.1 two component heavy metal response transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 1e-30 41
Dd703_3722 YP_002989299.1 two component heavy metal response transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 1e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dd703_3722 YP_002989299.1 two component heavy metal response transcriptional regulator, winged helix family VFG0596 Protein 2e-54 53
Dd703_3722 YP_002989299.1 two component heavy metal response transcriptional regulator, winged helix family VFG1390 Protein 4e-37 43
Dd703_3722 YP_002989299.1 two component heavy metal response transcriptional regulator, winged helix family VFG1386 Protein 4e-33 43
Dd703_3722 YP_002989299.1 two component heavy metal response transcriptional regulator, winged helix family VFG1389 Protein 2e-33 43