Gene Information

Name : Rpic12D_3731 (Rpic12D_3731)
Accession : YP_002983662.1
Strain :
Genome accession: NC_012857
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 289098 - 289580 bp
Length : 483 bp
Strand : +
Note : KEGG: rso:RS05447 transcription regulator protein; TIGRFAM: Cd(II)/Pb(II)-responsive transcriptional regulator; PFAM: transcription regulator MerR DNA binding; regulatory protein MerR; SMART: regulatory protein MerR

DNA sequence : 
ATGAAAATTGGCGAGCTCGCCCAGCGCACGGGCATCAGCATCGAAACCATCCGCTTCTATGAGGCGCAGGGCCTGCTGCC
GCCGCCGGCGCGCGCCGCCAACAACTACCGCGTCTACTCAGCCGAACATGCCGAGCAACTGGCCTTCATTGCGAAGTGCC
GGTCGCTCGACATGGCACACACTGAAATCCACCGGCTGCTCGAATTGCAGGCCAACCCGCAGGCCTCGTGCGAAGAGATC
AACAACCTGCTCGATGAACACCTGCGCCACGTGGAAACGCGCATCGCCGAACTGACCGAGCTCAGGCGCCAGATCGAGGC
GATTGGCCGGCGCTGCACGACGGCGGCGTCCGTGGCCGAATGCGGCGTGTTGCAGTCCCTGCATGAAGAGGCGGTCGCAG
CGAGCCCTCACGGCCACGGCCACGGCCACGACCACGGCGACGCCGAACACAGCCATCGGCACATCCGCGGGGTGCATCGC
TGA

Protein sequence : 
MKIGELAQRTGISIETIRFYEAQGLLPPPARAANNYRVYSAEHAEQLAFIAKCRSLDMAHTEIHRLLELQANPQASCEEI
NNLLDEHLRHVETRIAELTELRRQIEAIGRRCTTAASVAECGVLQSLHEEAVAASPHGHGHGHDHGDAEHSHRHIRGVHR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
cadR ADZ05769.1 MerR family transcriptional regulator Not tested AbaR11 Protein 3e-32 48
cadR ACS32041.1 MerR family transcriptional regulator Not tested AbaR5 Protein 4e-32 48
ACICU_00234 YP_001844893.1 transcriptional regulator Not tested AbaR20 Protein 4e-32 48
pbrR CAJ77021.1 transcription regulator Not tested AbaR1 Protein 3e-32 48
pbrR CAJ77094.1 Transcriptional regulator Not tested AbaR1 Protein 2e-32 48
cadR AGK36653.1 MerR family transcriptional regulator Not tested AbaR26 Protein 2e-32 48
cadR ACN81029.1 MerR family transcriptional regulator Not tested AbaR5 Protein 3e-32 48
ORF C98 AAN62191.1 putative transcriptional regulator Not tested PAGI-2(C) Protein 3e-29 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rpic12D_3731 YP_002983662.1 MerR family transcriptional regulator BAC0058 Protein 6e-32 48
Rpic12D_3731 YP_002983662.1 MerR family transcriptional regulator BAC0301 Protein 3e-26 45