Gene Information

Name : Rleg_0727 (Rleg_0727)
Accession : YP_002974569.1
Strain : Rhizobium leguminosarum WSM1325
Genome accession: NC_012850
Putative virulence/resistance : Unknown
Product : IS66 Orf2 family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 758287 - 758634 bp
Length : 348 bp
Strand : +
Note : PFAM: IS66 Orf2 family protein; KEGG: oan:Oant_4787 IS66 Orf2 family protein

DNA sequence :

ATGATTGGGCCTGGGACCGGCGTTCGGGTGTATCTTGCGTGCGGGATCACGGATATGCGCAAGGGAGTAGAAGGCCTTGC
CGCGCTTGCGCAGGATGTTTTGCGTCAGAAGCCGACTGGCGGCGCGGTCTTCGCCTTTCGCGGCAAGCGTGGCGATCGTT
TGAAGCTGCTGTATTTTGATGGCCAGGGCTTCTGCCTGTATTACAAGATCTTGCAGAAGGGGCGGTTTCCTTGGCCTTCG
GCATCCGACGGGACTGCCCGGCTGACGTCGGCCCAACTGGCGATGTTGTGGGAAGGGATCGATTGGCGTCGTCCTGATTG
GGGTGCGCCACCGGCCCGTGTCGGGTGA

Protein sequence :

MIGPGTGVRVYLACGITDMRKGVEGLAALAQDVLRQKPTGGAVFAFRGKRGDRLKLLYFDGQGFCLYYKILQKGRFPWPS
ASDGTARLTSAQLAMLWEGIDWRRPDWGAPPARVG

• Homologs from PAI DB

Gene	GenBank Accn	Product	Virulance or Resistance	PAI or REI	Alignment Type	E-val	Identity
unnamed	AAL99258.1	unknown	Not tested	LEE	Protein	6e-23	55
Z5097	NP_290248.1	prophage-associated protein	Not tested	LEE	Protein	8e-23	55
unnamed	ACU09438.1	IS66 family element orf2	Not tested	LEE	Protein	6e-23	55
ECs4546	NP_312573.1	hypothetical protein	Not tested	LEE	Protein	8e-23	55
c3561	NP_755436.1	hypothetical protein	Not tested	PAI I CFT073	Protein	5e-23	55
ECUMN_3327	YP_002414007.1	putative transposase ORF2, IS66 family	Not tested	Not named	Protein	5e-23	55
Z1132	NP_286667.1	hypothetical protein	Not tested	TAI	Protein	4e-22	55
Z1571	NP_287075.1	hypothetical protein	Not tested	TAI	Protein	4e-22	55
unnamed	AAC31493.1	L0014	Not tested	LEE	Protein	6e-23	55
c3578	NP_755453.1	hypothetical protein	Not tested	PAI I CFT073	Protein	8e-23	55
hp4	AAC61716.1	Hp4	Not tested	PAI I CFT073	Protein	6e-23	55
Z4336	NP_289561.1	hypothetical protein	Not tested	OI-122	Protein	8e-23	55
BCAM0247	YP_002232879.1	putative transposase	Not tested	BcenGI11	Protein	1e-20	55
unnamed	AAL08461.1	unknown	Not tested	SRL	Protein	1e-22	53
l0014	CAD33776.1	L0014 protein	Not tested	PAI I 536	Protein	1e-16	51
aec52	AAW51735.1	Aec52	Not tested	AGI-3	Protein	1e-24	49
unnamed	ADD91739.1	hypothetical protein	Not tested	PAI-I AL862	Protein	1e-24	49
pB171ORF50	CAD66190.1	ORF50 protein of pB171	Not tested	PAI III 536	Protein	2e-24	48
ECUMN_3364	YP_002414037.1	putative transposase ORF2, IS66 family	Not tested	Not named	Protein	1e-21	47
Z1160	NP_286695.1	hypothetical protein	Not tested	TAI	Protein	7e-22	47
Z1599	NP_287103.1	hypothetical protein	Not tested	TAI	Protein	7e-22	47
Z4316	NP_289542.1	hypothetical protein	Not tested	OI-122	Protein	2e-21	46
ECO103_3553	YP_003223420.1	hypothetical protein	Not tested	LEE	Protein	2e-21	46
ECO103_3567	YP_003223430.1	hypothetical protein	Not tested	LEE	Protein	9e-21	46
Z4338	NP_289563.1	hypothetical protein	Not tested	OI-122	Protein	9e-21	46

• Homologs from VFDB (virulence genes)

Gene	GenBank Accn	Product	ID of source DB	Alignment Type	E-val	Identity
Rleg_0727	YP_002974569.1	IS66 Orf2 family protein	VFG1709	Protein	2e-23	55
Rleg_0727	YP_002974569.1	IS66 Orf2 family protein	VFG0792	Protein	2e-23	55
Rleg_0727	YP_002974569.1	IS66 Orf2 family protein	VFG1698	Protein	1e-23	55
Rleg_0727	YP_002974569.1	IS66 Orf2 family protein	VFG1052	Protein	5e-23	53
Rleg_0727	YP_002974569.1	IS66 Orf2 family protein	VFG1517	Protein	6e-17	51
Rleg_0727	YP_002974569.1	IS66 Orf2 family protein	VFG1665	Protein	1e-24	48
Rleg_0727	YP_002974569.1	IS66 Orf2 family protein	VFG1737	Protein	3e-22	47