
| Name : fliQ (Rleg_0376) Accession : YP_002974226.1 Strain : Rhizobium leguminosarum WSM1325 Genome accession: NC_012850 Putative virulence/resistance : Virulence Product : flagellar biosynthesis protein FliQ Function : - COG functional category : N : Cell motility COG ID : COG1987 EC number : - Position : 384126 - 384392 bp Length : 267 bp Strand : + Note : FliQ, with proteins FliP and FliR, forms the core of the central channel in the flagella export apparatus; Bradyrhizobium have one thick flagellum and several thin flagella; the protein in this cluster is associated with the thick flagellum DNA sequence : ATGAATGAAGCTGATGCATTGGATCTGTTCCAGGCGGCGATCTGGACCGTGTTGATTGCTGCCGGTCCCGCCGTCATCGC CGCGATGGTGGTAGGTCTCGTCATTGCCTTGATCCAGGCGCTGACCCAGGTGCAGGAAGCGACACTGACTTTCGTGCCGA AGATCGTCGCGGTGCTGATCACGGTCGGTGTCACCGCGCCGTTCGTCGGTTCGCAGATCTCGATTTTCACCAATCTGGTC TTCTCGCGCATCCAGTCCGGCTTCTAG Protein sequence : MNEADALDLFQAAIWTVLIAAGPAVIAAMVVGLVIALIQALTQVQEATLTFVPKIVAVLITVGVTAPFVGSQISIFTNLV FSRIQSGF | 
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity | 
| lscS | AAO18039.1 | LscS | Virulence | TTSS locus | Protein | 4e-11 | 44 | 
| escS | YP_003232139.1 | T3SS structure protein EscS | Virulence | LEE | Protein | 2e-09 | 42 | 
| escS | AAK26701.1 | EscS | Virulence | LEE | Protein | 1e-09 | 42 | 
| escS | AAL57528.1 | EscS | Virulence | LEE | Protein | 1e-09 | 42 | 
| escS | CAC81848.1 | EscS protein | Virulence | LEE II | Protein | 1e-09 | 42 | 
| unnamed | AAL06355.1 | EscS | Virulence | LEE | Protein | 1e-09 | 42 | 
| escS | YP_003223489.1 | T3SS structure protein EscS | Virulence | LEE | Protein | 2e-09 | 42 | 
| escS | CAI43888.1 | EscS protein | Virulence | LEE | Protein | 2e-09 | 41 | 
| escS | AFO66341.1 | putative LEE-encoded type III secretion system factor | Virulence | SESS LEE | Protein | 3e-08 | 41 | 
| escS | AFO66401.1 | putative LEE-encoded type III secretion system factor | Virulence | SESS LEE | Protein | 3e-08 | 41 | 
 
 
  