|
Name : rpmJ (Bgr_17250) Accession : YP_002972538.1 Strain : Bartonella grahamii as4aup Genome accession: NC_012846 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L36 Function : - COG functional category : - COG ID : - EC number : - Position : 1994436 - 1994564 bp Length : 129 bp Strand : + Note : smallest protein in the large subunit; similar to what is found with protein L31 and L33 several bacterial genomes contain paralogs which may be regulated by zinc; the protein from Thermus thermophilus has a zinc-binding motif and contains a bound zinc io DNA sequence : ATGATGAAAATTAAAAATTCGCTTAAAGCACTAAAGGAGCGCCACCGTAACAATCGTTTGGTGCGTCGTAAGGGTCGTAT TTATATTCTTAATAAAACGAACCCACGTTTTAGAGCGCGTCAGGGCTAA Protein sequence : MMKIKNSLKALKERHRNNRLVRRKGRIYILNKTNPRFRARQG |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| rpmJ | YP_001800879.1 | 50S ribosomal protein L36 | Not tested | Not named | Protein | 3e-06 | 49 |
