Gene Information

Name : MexAM1_META2p0366 (MexAM1_META2p0366)
Accession : YP_002966571.1
Strain :
Genome accession: NC_012811
Putative virulence/resistance : Resistance
Product : putative arsenate reductase (glutaredoxin family)
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG1393
EC number : -
Position : 311531 - 311959 bp
Length : 429 bp
Strand : +
Note : Evidence 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pe : putative enzyme

DNA sequence : 
ATGATGGACGTCGTCATCTACCACAACCCGGATTGTGGCACGTCCCGCAACACCCTGGCGCTCATCCGCAACGCCGGCAT
AGAGCCGCACGTCGTCGAGTATCTGAAGACGCCACCGAACCGGCTCCTGGTGCGCCAGCTTGCCGACCGAGCCGGCGTTC
CTGTCCGTGGTCTCCTGCGTGAGAAGGGCACCCCCTACGTCGAGCTTAACCTCGGCGACGAAAACCTCACGGACGATCAA
CTACTGGACGCCATCGCCGAGCACCCGATCCTTCTGAACCGCCCCCTGGTGGTGAGCCCGAAGGGCGTCGCCCTGTGCCG
TCCCTCCGAAGCGGTCCTCGACCTCCTGCCGACCCAGCAAGGTGAGTTCGTCAAGGAGGACGGCGAGCGCGTCGTCGACG
AGCACGGGCGCCGCGTCGCCACCGCCTGA

Protein sequence : 
MMDVVIYHNPDCGTSRNTLALIRNAGIEPHVVEYLKTPPNRLLVRQLADRAGVPVRGLLREKGTPYVELNLGDENLTDDQ
LLDAIAEHPILLNRPLVVSPKGVALCRPSEAVLDLLPTQQGEFVKEDGERVVDEHGRRVATA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
arsC2 YP_001007634.1 arsenate reductase Not tested YAPI Protein 2e-35 57
arsC ADZ05768.1 arsenate reductase Not tested AbaR11 Protein 4e-33 55
arsC AFC76436.1 ArsC Not tested AbaR5 Protein 5e-33 55
arsR CAJ77019.1 arsenate reductase Not tested AbaR1 Protein 3e-33 55

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MexAM1_META2p0366 YP_002966571.1 putative arsenate reductase (glutaredoxin family) BAC0584 Protein 2e-37 58
MexAM1_META2p0366 YP_002966571.1 putative arsenate reductase (glutaredoxin family) BAC0583 Protein 1e-37 58
MexAM1_META2p0366 YP_002966571.1 putative arsenate reductase (glutaredoxin family) BAC0585 Protein 9e-36 55
MexAM1_META2p0366 YP_002966571.1 putative arsenate reductase (glutaredoxin family) BAC0582 Protein 2e-36 55