Gene Information

Name : cueR (MexAM1_META1p2622)
Accession : YP_002963669.1
Strain : Methylobacterium extorquens AM1
Genome accession: NC_012808
Putative virulence/resistance : Resistance
Product : DNA-binding transcriptional activator of copper-responsive regulon genes
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 2753794 - 2754246 bp
Length : 453 bp
Strand : +
Note : Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; PubMedId : 10915804, 11399769, 12958362, 21065101; Product type r : regulator

DNA sequence :
ATGCGGGATCCGACCATCGGGAAGGCGGCGCGGGAGGCCGGCGTCGGCGTCGAGACCATCCGGTTCTACGAGCGCCAGGG
CTTGATCGCGCAGCCGGCCAAGGGGGCCGGCTATCGGACCTACCCGCCCGAGGTGATCGCCCGCATCCGCTTCATCCGGC
AGGCCCAGAGGATCGGGTTCTCCCTCAAGGAGGCGCAGGAGCTCCTCGCCCTGCGCGCCGACCCGCAGGCCGACTGCGGC
GACGTGCGGGCCCGGGCCCGGCACAAGATCGCCGAGGTGGACGCGAGGATCGCCGAACTCCTGCGCGTCCGCGCCGCCCT
GGAGGCCGTGGTCGCCTCGTGCCCGGGCCACGGCGGGCTGGGTGGCTGCACCATCCTGGAAGCCCTCGACGAGGCACCGC
CGGCACCGGCGGCGTGCCGATGCGGCGCGCCGAGAAAGAGGAAGACGCCATGA

Protein sequence :
MRDPTIGKAAREAGVGVETIRFYERQGLIAQPAKGAGYRTYPPEVIARIRFIRQAQRIGFSLKEAQELLALRADPQADCG
DVRARARHKIAEVDARIAELLRVRAALEAVVASCPGHGGLGGCTILEALDEAPPAPAACRCGAPRKRKTP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 9e-09 42
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 4e-13 42
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 1e-09 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cueR YP_002963669.1 DNA-binding transcriptional activator of copper-responsive regulon genes BAC0688 Protein 1e-10 41