Gene Information

Name : DMR_p1_00080 (DMR_p1_00080)
Accession : YP_002956014.1
Strain :
Genome accession: NC_012797
Putative virulence/resistance : Unknown
Product : putative transposase orf2
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 6268 - 6621 bp
Length : 354 bp
Strand : +
Note : -

DNA sequence :
ATGATGCTGCCGGCAAACGACGTTCGGGTTTACTTGGCCCTGGGGGCCACGGACATGCGCAAGGCCATCGACGGCCTGTC
CATCCTGGTGTCACAGCAGCTTACGCTCGATCCGTTCGCCGGCCACTTGTTCGGATTTTGTAACCGCAGTCGGACTATCG
TCAAGCTGCTCTACTGGGATCGCAATGGCTTTTGTCTCTGGCAAAAGCGCCTGGAGCGCCATGTGTTTCGCTGGCCAACT
CACGAGGCCGAGGTGCTGTCCATCGACTCCAGGCAGCTCGCTTGGCTGCTCGACGGACTTGATCCTCTGGCCGTGAAAGG
GCATTCCCGGCTAGAGTATTCGACGCTCTTTTGA

Protein sequence :
MMLPANDVRVYLALGATDMRKAIDGLSILVSQQLTLDPFAGHLFGFCNRSRTIVKLLYWDRNGFCLWQKRLERHVFRWPT
HEAEVLSIDSRQLAWLLDGLDPLAVKGHSRLEYSTLF

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed AAF71493.1 unknown Not tested Hrp PAI Protein 2e-17 47
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 2e-12 44
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 2e-12 44
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 2e-13 44
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 2e-13 44
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-13 43
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 8e-12 43
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 8e-12 43
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 2e-12 42
unnamed AAL08461.1 unknown Not tested SRL Protein 2e-12 42
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 4e-12 42
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 4e-12 42
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 4e-12 42
unnamed AAC31493.1 L0014 Not tested LEE Protein 2e-12 42
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 4e-12 42
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 2e-12 42
unnamed AAL99258.1 unknown Not tested LEE Protein 2e-12 42
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 3e-12 41
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 3e-12 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DMR_p1_00080 YP_002956014.1 putative transposase orf2 VFG1737 Protein 7e-14 43
DMR_p1_00080 YP_002956014.1 putative transposase orf2 VFG1052 Protein 1e-12 42
DMR_p1_00080 YP_002956014.1 putative transposase orf2 VFG1709 Protein 1e-12 42
DMR_p1_00080 YP_002956014.1 putative transposase orf2 VFG0792 Protein 1e-12 42
DMR_p1_00080 YP_002956014.1 putative transposase orf2 VFG1698 Protein 9e-13 41