Gene Information

Name : DMR_09120 (DMR_09120)
Accession : YP_002952289.1
Strain : Desulfovibrio magneticus RS-1
Genome accession: NC_012796
Putative virulence/resistance : Unknown
Product : transposase orf2 for insertion sequence element
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 1031063 - 1031416 bp
Length : 354 bp
Strand : +
Note : -

DNA sequence :
ATGATGTCGCCGGTAAGCGGCGTCCGGGTTTATTTGGCTCTGGGAGCCACAGACATGCGCAAGTCCATCGACGGGCTGTC
CATCCTGGTTTCACGGCAGCTGCAACTCGATCCGTTTGCCGGTCACCTTTTCGGCTTTTGCAACCGCAGCCGGACGATCA
TCAAGCTGCTCTACTGGGATCGCAACGGCTTTTGTCTGTGGCACAAGCGTCTGGAGCGGCATGTGTTTCGCTGGCCAACC
CGCGAGGCGGAGGTGCTTGCCATTGACTCCCGGCAACTGGCCTGGCTGCTTGATGGTCTCGATCCCCTGGCCGTGACGGG
ACACTCCCGTCTGGAGTATTCGACGCTCTTTTAG

Protein sequence :
MMSPVSGVRVYLALGATDMRKSIDGLSILVSRQLQLDPFAGHLFGFCNRSRTIIKLLYWDRNGFCLWHKRLERHVFRWPT
REAEVLAIDSRQLAWLLDGLDPLAVTGHSRLEYSTLF

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 4e-14 48
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 4e-14 48
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 5e-14 47
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 6e-13 46
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 6e-13 46
unnamed AAF71493.1 unknown Not tested Hrp PAI Protein 1e-17 45
unnamed AAL08461.1 unknown Not tested SRL Protein 9e-13 43
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 2e-13 43
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 2e-13 43
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 6e-12 43
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 6e-12 43
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 1e-12 42
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-12 42
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 5e-13 42
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 2e-12 42
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 2e-12 42
unnamed AAC31493.1 L0014 Not tested LEE Protein 1e-12 42
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 2e-12 42
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 1e-12 42
unnamed AAL99258.1 unknown Not tested LEE Protein 1e-12 42
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 1e-12 41
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-12 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DMR_09120 YP_002952289.1 transposase orf2 for insertion sequence element VFG1737 Protein 1e-14 47
DMR_09120 YP_002952289.1 transposase orf2 for insertion sequence element VFG1052 Protein 4e-13 43
DMR_09120 YP_002952289.1 transposase orf2 for insertion sequence element VFG1665 Protein 2e-13 42
DMR_09120 YP_002952289.1 transposase orf2 for insertion sequence element VFG1709 Protein 4e-13 42
DMR_09120 YP_002952289.1 transposase orf2 for insertion sequence element VFG0792 Protein 4e-13 42
DMR_09120 YP_002952289.1 transposase orf2 for insertion sequence element VFG1698 Protein 4e-13 41