Gene Information

Name : GWCH70_2219 (GWCH70_2219)
Accession : YP_002950194.1
Strain : Geobacillus sp. WCH70
Genome accession: NC_012793
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2275960 - 2276682 bp
Length : 723 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: gka:GK2279 two-component response regulator

DNA sequence :
ATGGATAAAGATCAACAAGTCAAAATTTTAGTAGTAGATGATGAAGAACGCATTCGGCGCTTACTAAAAATGTATTTAGA
GCGCGAAAACTATATCATTGATGAGGCTGATAACGGCGATGACGCGCTCGAAAAAGCGCTCGAAAACGACTATGATGTCA
TTTTGCTTGACCTCATGCTGCCAGGGAGGGACGGTATTGAGGTATGTAAAGGAATTCGCGAAAAGAAAGCAACCCCGATT
ATTATGCTGACAGCAAAAGGGGAAGAATCAAACCGTGTTCAAGGGTTTGAAGTAGGGACAGACGATTATATTGTTAAGCC
ATTTAGCCCGCGCGAGGTCGTATTGCGCGTAAAAGCGCTGTTGCGGCGTGCGGCGAATACTGCGTATGTTCTTGCTGACA
CGACCGCAAAAGATGTGCTCGTTTTTCCGCATTTAACAATTGATAACGATGCCCATCGCGTAACGGTTGACGGTCAGGAA
GTGAATTTAACGCCGAAGGAATACGAGTTGCTTCTATTTTTGGCAAGATCTCCAGATAAAGTATTTGACCGTGAACAGCT
ATTGAAAGAAGTATGGCACTACGAATTTTTTGGCGATTTGCGCACGGTAGATACCCATATTAAACGTTTGCGTGAAAAGT
TGAATAAAGTCTCCCCAACGGCGGCAAAGATGATCGTAACCGTTTGGGGGGTTGGCTATAAATTTGAGGTAGTGAATGAC
TAA

Protein sequence :
MDKDQQVKILVVDDEERIRRLLKMYLERENYIIDEADNGDDALEKALENDYDVILLDLMLPGRDGIEVCKGIREKKATPI
IMLTAKGEESNRVQGFEVGTDDYIVKPFSPREVVLRVKALLRRAANTAYVLADTTAKDVLVFPHLTIDNDAHRVTVDGQE
VNLTPKEYELLLFLARSPDKVFDREQLLKEVWHYEFFGDLRTVDTHIKRLREKLNKVSPTAAKMIVTVWGVGYKFEVVND

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-39 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-39 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GWCH70_2219 YP_002950194.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-46 49
GWCH70_2219 YP_002950194.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-46 49
GWCH70_2219 YP_002950194.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-46 49
GWCH70_2219 YP_002950194.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-46 49
GWCH70_2219 YP_002950194.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-46 49
GWCH70_2219 YP_002950194.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-46 49
GWCH70_2219 YP_002950194.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-46 49
GWCH70_2219 YP_002950194.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-46 49
GWCH70_2219 YP_002950194.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-46 49
GWCH70_2219 YP_002950194.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-46 49
GWCH70_2219 YP_002950194.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 5e-47 47
GWCH70_2219 YP_002950194.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 2e-49 46
GWCH70_2219 YP_002950194.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 7e-42 45
GWCH70_2219 YP_002950194.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 2e-41 45
GWCH70_2219 YP_002950194.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 3e-43 44
GWCH70_2219 YP_002950194.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 3e-43 44
GWCH70_2219 YP_002950194.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 3e-43 44
GWCH70_2219 YP_002950194.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 3e-43 44
GWCH70_2219 YP_002950194.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 2e-38 44
GWCH70_2219 YP_002950194.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 3e-43 44
GWCH70_2219 YP_002950194.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 3e-43 44
GWCH70_2219 YP_002950194.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 3e-43 44
GWCH70_2219 YP_002950194.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 3e-43 44
GWCH70_2219 YP_002950194.1 winged helix family two component transcriptional regulator DQ212986.1.gene4.p01 Protein 7e-39 44
GWCH70_2219 YP_002950194.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 2e-35 43
GWCH70_2219 YP_002950194.1 winged helix family two component transcriptional regulator BAC0039 Protein 2e-35 43
GWCH70_2219 YP_002950194.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 1e-35 43
GWCH70_2219 YP_002950194.1 winged helix family two component transcriptional regulator AF130997.1.orf0.gene Protein 2e-35 42
GWCH70_2219 YP_002950194.1 winged helix family two component transcriptional regulator AM180355.1.gene1830. Protein 7e-38 42
GWCH70_2219 YP_002950194.1 winged helix family two component transcriptional regulator CP004022.1.gene1676. Protein 7e-37 42
GWCH70_2219 YP_002950194.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 5e-35 42
GWCH70_2219 YP_002950194.1 winged helix family two component transcriptional regulator BAC0596 Protein 5e-35 42
GWCH70_2219 YP_002950194.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 4e-42 41
GWCH70_2219 YP_002950194.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 2e-34 41
GWCH70_2219 YP_002950194.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 9e-35 41
GWCH70_2219 YP_002950194.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 1e-34 41
GWCH70_2219 YP_002950194.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 3e-41 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GWCH70_2219 YP_002950194.1 winged helix family two component transcriptional regulator VFG1563 Protein 8e-40 42
GWCH70_2219 YP_002950194.1 winged helix family two component transcriptional regulator VFG1702 Protein 2e-39 42