Gene Information

Name : GWCH70_1697 (GWCH70_1697)
Accession : YP_002949734.1
Strain : Geobacillus sp. WCH70
Genome accession: NC_012793
Putative virulence/resistance : Resistance
Product : copper ion binding protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2608
EC number : -
Position : 1777979 - 1778182 bp
Length : 204 bp
Strand : -
Note : TIGRFAM: copper ion binding protein; PFAM: Heavy metal transport/detoxification protein; KEGG: gka:GK0903 mercuric ion-binding protein

DNA sequence :
ATGACCATTACATTACAAGTACAAGGAATGACATGCGGACATTGCAAAGCGGCGGTGACCAATGCCCTTCAAGCGTTGGA
TGGCGTCAGCCGTGTAGAAGTGCATTTGCAAGAAGGAACTGTCGATGTGGAGTATGATGAAACAAAGGTCAGCGTAGAAA
AACTGAAAGAAGCGATTGAAGAGCAAGGATATAATGTGAAGTAA

Protein sequence :
MTITLQVQGMTCGHCKAAVTNALQALDGVSRVEVHLQEGTVDVEYDETKVSVEKLKEAIEEQGYNVK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 1e-10 44
merP AFG30122.1 MerP Not tested PAGI-2 Protein 1e-10 44
merP AGK07023.1 MerP Not tested SGI1 Protein 1e-10 44
merP AGK07081.1 MerP Not tested SGI1 Protein 1e-10 44
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 2e-10 44
merP ABQ57373.1 MerP Not tested SGI1 Protein 1e-10 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GWCH70_1697 YP_002949734.1 copper ion binding protein BAC0231 Protein 8e-11 43
GWCH70_1697 YP_002949734.1 copper ion binding protein BAC0679 Protein 1e-10 41
GWCH70_1697 YP_002949734.1 copper ion binding protein BAC0678 Protein 1e-10 41