Name : GWCH70_1697 (GWCH70_1697) Accession : YP_002949734.1 Strain : Geobacillus sp. WCH70 Genome accession: NC_012793 Putative virulence/resistance : Resistance Product : copper ion binding protein Function : - COG functional category : P : Inorganic ion transport and metabolism COG ID : COG2608 EC number : - Position : 1777979 - 1778182 bp Length : 204 bp Strand : - Note : TIGRFAM: copper ion binding protein; PFAM: Heavy metal transport/detoxification protein; KEGG: gka:GK0903 mercuric ion-binding protein DNA sequence : ATGACCATTACATTACAAGTACAAGGAATGACATGCGGACATTGCAAAGCGGCGGTGACCAATGCCCTTCAAGCGTTGGA TGGCGTCAGCCGTGTAGAAGTGCATTTGCAAGAAGGAACTGTCGATGTGGAGTATGATGAAACAAAGGTCAGCGTAGAAA AACTGAAAGAAGCGATTGAAGAGCAAGGATATAATGTGAAGTAA Protein sequence : MTITLQVQGMTCGHCKAAVTNALQALDGVSRVEVHLQEGTVDVEYDETKVSVEKLKEAIEEQGYNVK |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
merP | AFG30122.1 | MerP | Not tested | PAGI-2 | Protein | 1e-10 | 44 |
merP | AGK07023.1 | MerP | Not tested | SGI1 | Protein | 1e-10 | 44 |
merP | AGK07081.1 | MerP | Not tested | SGI1 | Protein | 1e-10 | 44 |
merP | YP_006098389.1 | mercuric ion transport protein | Not tested | Tn2411 | Protein | 2e-10 | 44 |
merP | ABQ57373.1 | MerP | Not tested | SGI1 | Protein | 1e-10 | 44 |
merP | AET25399.1 | MerP | Not tested | PAGI-2(C) | Protein | 1e-10 | 44 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
GWCH70_1697 | YP_002949734.1 | copper ion binding protein | BAC0231 | Protein | 8e-11 | 43 |
GWCH70_1697 | YP_002949734.1 | copper ion binding protein | BAC0678 | Protein | 1e-10 | 41 |
GWCH70_1697 | YP_002949734.1 | copper ion binding protein | BAC0679 | Protein | 1e-10 | 41 |