Gene Information

Name : Vapar_5448 (Vapar_5448)
Accession : YP_002947310.1
Strain :
Genome accession: NC_012792
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 152024 - 152713 bp
Length : 690 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: aav:Aave_3002 two component transcriptional regulator

DNA sequence :
ATGAACAGAAGCATCCTGATTGTCGAAGACGATCCCCGTGTCGCCGATTTCCTGGTCCGCGGGCTGAAGGCGGAAGGCTT
TGCGGTGACGCATGCCCGCACCGGTCCGCAGGGGCTGGAGCTGGCGCGCCGCGGAGACCTCGCGCTTTTGATCCTCGATC
TGATGCTGCCGGGCATCAACGGCCTGGAGCTGTGCCAGACCTTCCGCGCCGAGGGCGGCCAGACGCCGGTGCTGATGCTG
ACCGCCATGAGCACGACCGAAGACAAGGTGAACGGCCTGCGCCTCGGCGCCGACGACTACCTGACCAAGCCCTTCGACTT
CGAGGAACTGCTCGCGCGCATCGAGGCGCTGCTGCGCCGCGGCCGGGACCTCAGGCTGCGGGTCACGACCTTGCGGGTGG
CCAACCTGGTGCTGGACCGCGAACGCATGCGCGTGGAGCGCGCGGGGCAGCCGATCACGCTGACGGCCAAGGAACTGGCA
TTTCTCGAGCTGCTCATGAGCGCACCCGGGCGGGTGTACAGCCGCGAACGCATCCTGGCCACTGTCTGGGGCACGCACGA
GGATCCGCTCACCAATATCGTGGATGTCTACGTGCGGCGACTTCGCATGAAGATCGACGGCGACCACGCGGTGCAGCTGC
TGCAGACCGTGCGCGGCCTCGGATACCGCATCAGCGAGACGGCGGGCTAG

Protein sequence :
MNRSILIVEDDPRVADFLVRGLKAEGFAVTHARTGPQGLELARRGDLALLILDLMLPGINGLELCQTFRAEGGQTPVLML
TAMSTTEDKVNGLRLGADDYLTKPFDFEELLARIEALLRRGRDLRLRVTTLRVANLVLDRERMRVERAGQPITLTAKELA
FLELLMSAPGRVYSRERILATVWGTHEDPLTNIVDVYVRRLRMKIDGDHAVQLLQTVRGLGYRISETAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-21 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-20 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Vapar_5448 YP_002947310.1 two component transcriptional regulator, winged helix family BAC0347 Protein 2e-24 46
Vapar_5448 YP_002947310.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 2e-22 45
Vapar_5448 YP_002947310.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 2e-22 45
Vapar_5448 YP_002947310.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 2e-22 45
Vapar_5448 YP_002947310.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 2e-22 45
Vapar_5448 YP_002947310.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 2e-22 45
Vapar_5448 YP_002947310.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 2e-22 45
Vapar_5448 YP_002947310.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 2e-22 45
Vapar_5448 YP_002947310.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 2e-22 45
Vapar_5448 YP_002947310.1 two component transcriptional regulator, winged helix family BAC0111 Protein 9e-26 45
Vapar_5448 YP_002947310.1 two component transcriptional regulator, winged helix family BAC0083 Protein 1e-26 45
Vapar_5448 YP_002947310.1 two component transcriptional regulator, winged helix family BAC0125 Protein 5e-25 45
Vapar_5448 YP_002947310.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 7e-21 44
Vapar_5448 YP_002947310.1 two component transcriptional regulator, winged helix family BAC0638 Protein 6e-22 44
Vapar_5448 YP_002947310.1 two component transcriptional regulator, winged helix family BAC0197 Protein 3e-22 44
Vapar_5448 YP_002947310.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 2e-17 43
Vapar_5448 YP_002947310.1 two component transcriptional regulator, winged helix family BAC0308 Protein 6e-25 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Vapar_5448 YP_002947310.1 two component transcriptional regulator, winged helix family VFG0596 Protein 1e-21 42
Vapar_5448 YP_002947310.1 two component transcriptional regulator, winged helix family VFG1390 Protein 1e-25 42